Property Summary

NCBI Gene PubMed Count 167
PubMed Score 884.89
PubTator Score 288.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Leprosy 73 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 4.111 2.1
Disease Target Count Z-score Confidence
Spiradenoma 7 5.749 2.9
Epidermal appendage tumor 2 3.927 2.0
Proteinuria 144 3.02 1.5

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.455 1.1e-06
adult high grade glioma -1.700 3.2e-05
Amyotrophic lateral sclerosis 1.293 1.5e-08
atypical teratoid / rhabdoid tumor -2.200 2.3e-10
Breast cancer -1.200 5.3e-09
cutaneous lupus erythematosus 1.100 3.4e-03
dermatomyositis 1.400 8.2e-03
ependymoma -1.500 1.0e-02
glioblastoma -1.500 1.3e-06
group 3 medulloblastoma -1.600 8.6e-04
hepatocellular carcinoma -1.100 6.5e-04
juvenile dermatomyositis 1.306 4.3e-10
lung cancer -1.700 1.3e-03
malignant mesothelioma -1.900 3.0e-07
medulloblastoma, large-cell -2.300 2.5e-04
non-small cell lung cancer -1.085 1.3e-13
oligodendroglioma -1.100 2.9e-02
osteosarcoma -1.738 5.7e-04
ovarian cancer -1.900 8.8e-08
Pick disease 1.500 2.6e-05
primary Sjogren syndrome 1.100 7.9e-03
primitive neuroectodermal tumor -1.100 1.1e-03
psoriasis 1.600 2.2e-04
tuberculosis and treatment for 6 months 1.300 4.1e-03

 GWAS Trait (1)

Gene RIF (144)

AA Sequence

MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQI      1 - 70
GLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEE     71 - 140
KFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIEDDDT    141 - 210
ALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRF    211 - 280
DGVQLCSFACVESTILLHINDIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRN    281 - 350
RSELFYTLNGSSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLP    351 - 420
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPPFYGVIRW    421 - 490
IGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPVSNQIERCNS    491 - 560
LAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDV    561 - 630
EYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLL    631 - 700
KIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIF    701 - 770
PSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL    771 - 840
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCP    841 - 910
EVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK                            911 - 956
//

Text Mined References (176)

PMID Year Title