Property Summary

NCBI Gene PubMed Count 149
Grant Count 101
R01 Count 64
Funding $15,377,387.71
PubMed Score 806.35
PubTator Score 288.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.001
malignant mesothelioma -2.300 0.000
ependymoma -1.500 0.010
oligodendroglioma -1.100 0.029
cutaneous lupus erythematosus 1.100 0.003
psoriasis 1.600 0.000
osteosarcoma -1.738 0.001
glioblastoma -1.900 0.000
group 3 medulloblastoma -2.300 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.100 0.001
juvenile dermatomyositis 1.907 0.000
Amyotrophic Lateral Sclerosis 1.293 0.000
acute quadriplegic myopathy 1.455 0.000
tuberculosis and treatment for 6 months 1.300 0.004
non-small cell lung cancer -1.085 0.000
lung cancer -2.700 0.001
pediatric high grade glioma -1.800 0.000
primary Sjogren syndrome 1.100 0.008
Pick disease 1.500 0.000
Breast cancer -1.200 0.000
ovarian cancer 2.300 0.000
dermatomyositis 1.400 0.008

Synonym

Accession Q9NQC7 O94934 Q7L3N6 Q96EH0 Q9NZX9
Symbols EAC
MFT
SBS
TEM
BRSS
CDMT
MFT1
CYLD1
CYLDI
USPL2

Gene

PDB

1IXD   1WHL   1WHM   2VHF  

 GWAS Trait (1)

Gene RIF (126)

PMID Text
26861065 Haplotype analysis was performed for the patients with multiple familial trichoepithelioma type 1, patients with familial cylindromatosis and a patient with Brooke-Spiegler syndrome, all of whom carry the same heterozygous nonsense CYLD mutation.
26719415 Deubiquitinase CYLD negatively regulates MyD88-mediated signaling by directly interacting with MyD88 and deubiquitinating nontypeable Haemophilus influenzae (NTHi)-induced K63-linked polyubiquitination of MyD88 at lysine 231.
26717101 Ultraviolet radiation induced CYLD translocation from the cytoplasm to microtubules, posttranslational modification and degradation in a proteasome-independent manner.
26370355 Clinical management of patients with germline CYLD mutations is challenging and we discuss genetic counselling and surgical interventions
26271973 Data show that inhibiting the expression of cylindromatosis (CYLD) gene can suppress the proliferation and migration of umbilical vein endothelial cells (HUVECs).
26056944 TRAF-6 mediates S. p-induced PAI-1 expression, and CYLD inhibits PAI-1 expression probably through deubiquitinating TRAF-6
25935309 CYLD interrupts the ERK- and p38-/AP-1 and c-Myc pathways to suppress Nrf2-operated antioxidative capacity, thereby enhancing oxidative stress in the heart.
25923723 Data suggest OPTN (optineurin) is involved in up-regulation of innate immunity in mitosis; mechanism involves phosphorylation/nuclear translocation of CYLD and phosphorylation/mitochondrial translocation of TBK1 (NF-kB-activating kinase).
25824771 Low CYLD expression is associated with colorectal cancer.
25782638 Phenotype-genotype correlations for clinical variants caused by CYLD mutations. [Review]
More...

AA Sequence

MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRIPSAKGKKNQI      1 - 70
GLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLSKGLQIDVGCPVKVQLRSGEE     71 - 140
KFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGVYQGKQLFQCDEDCGVFVALDKLELIEDDDT    141 - 210
ALESDYAGPGDTMQVELPPLEINSRVSLKVGETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRF    211 - 280
DGVQLCSFACVESTILLHINDIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRN    281 - 350
RSELFYTLNGSSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLP    351 - 420
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKENPPFYGVIRW    421 - 490
IGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCRPDSRFASLQPVSNQIERCNS    491 - 560
LAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNSCYLDSTLFCLFAFSSVLDTVLLRPKEKNDV    561 - 630
EYYSETQELLRTEIVNPLRIYGYVCATKIMKLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLL    631 - 700
KIRSAGQKVQDCYFYQIFMEKNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIF    701 - 770
PSLELNITDLLEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL    771 - 840
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCP    841 - 910
EVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK                            911 - 956
//

Text Mined References (158)

PMID Year Title
26997266 2016 CYLD Limits Lys63- and Met1-Linked Ubiquitin at Receptor Complexes to Regulate Innate Immune Signaling.
26861065 2016 The CYLD p.R758X worldwide recurrent nonsense mutation detected in patients with multiple familial trichoepithelioma type 1, Brooke-Spiegler syndrome and familial cylindromatosis represents a mutational hotspot in the gene.
26719415 2016 Deubiquitinase CYLD acts as a negative regulator for bacterium NTHi-induced inflammation by suppressing K63-linked ubiquitination of MyD88.
26717101 2016 UV Irradiation Triggers Cylindromatosis Translocation, Modification, and Degradation in a Proteasome-Independent Manner.
26670046 2015 LUBAC-Recruited CYLD and A20 Regulate Gene Activation and Cell Death by Exerting Opposing Effects on Linear Ubiquitin in Signaling Complexes.
26370355 2015 Inherited cylindromas: lessons from a rare tumour.
26271973 2015 [Inhibition of proliferation and migration of human umbilical vein endothelial cells by knockdown of cylindromatosis (CYLD) gene].
26056944 2015 Cylindromatosis (CYLD) inhibits Streptococcus pneumonia-induced plasminogen activator inhibitor-1 expression via interacting with TRAF-6.
25935309 2015 Deubiquitinating enzyme CYLD mediates pressure overload-induced cardiac maladaptive remodeling and dysfunction via downregulating Nrf2.
25923723 2015 Optineurin regulates the interferon response in a cell cycle-dependent manner.
More...