Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.08
PubTator Score 1.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.300 5.7e-04
atypical teratoid / rhabdoid tumor -1.700 5.1e-06
ependymoma -1.400 7.4e-05
glioblastoma -1.200 2.7e-04
group 3 medulloblastoma -1.900 7.5e-06
invasive ductal carcinoma -1.100 4.1e-02
lung cancer -2.400 3.9e-03
malignant mesothelioma 1.200 4.7e-05
medulloblastoma, large-cell -2.400 1.5e-04
ovarian cancer -1.600 2.4e-05
primitive neuroectodermal tumor -1.600 1.5e-03
subependymal giant cell astrocytoma -1.398 5.0e-03

Protein-protein Interaction (12)

AA Sequence

MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITAMKIPDSYQLS      1 - 70
PDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSSTMLGEGSQPDWPGGSRYDLD     71 - 140
EIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQNMARAIETQEGLGIEYDEDVVCDVCRSPEG    141 - 210
EDGNEMVFCDKCNVCVHQACYGILKVPTGSWLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCAL    211 - 280
WIPEVSIGCPEKMEPITKISHIPASRWALSCSLCKECTGTCIQCSMPSCVTAFHVTCAFDHGLEMRTILA    281 - 350
DNDEVKFKSFCQEHSDGGPRNEPTSEPTEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEPAEVAERLDLA    351 - 420
EALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVRNLCYMVTRRE    421 - 490
RTKHAICKLQEQIFHLQMKLIEQDLCRGLSTSFPIDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDP    491 - 560
APGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRLPAKKKPPPPPPQDGPGSRTTPDKAPKKTWG    561 - 630
QDAGSGKGGQGPPTRKPPRRTSSHLPSSPAAGDCPILATPESPPPLAPETPDEAASVAADSDVQVPGPAA    631 - 700
SPKPLGRLRPPRESKVTRRLPGARPDAGMGPPSAVAERPKVSLHFDTETDGYFSDGEMSDSDVEAEDGGV    701 - 770
QRGPREAGAEEVVRMGVLAS                                                      771 - 790
//

Text Mined References (18)

PMID Year Title