Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.08
PubTator Score 1.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 5.5214740091946E-13
sonic hedgehog group medulloblastoma 1482 2.28366327274302E-10
posterior fossa group A ependymoma 1511 1.18273427873546E-8
malignant mesothelioma 3163 1.26688185409694E-6
atypical teratoid / rhabdoid tumor 4369 5.07827903079304E-6
medulloblastoma, large-cell 6234 1.52952564601009E-4
glioblastoma 5572 2.73935824616945E-4
lung cancer 4473 5.32463056440582E-4
adult high grade glioma 2148 5.69985115193145E-4
primitive neuroectodermal tumor 3031 0.00154722268289017
subependymal giant cell astrocytoma 2287 0.0049767093960499
invasive ductal carcinoma 2950 0.0414297209106284

Expression

Synonym

Accession Q9NQC1 D3DQA3 Q6IE80 Q8TEK0 Q92513 Q96GQ6
Symbols PHF15
JADE-2

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG
C. elegans EggNOG Inparanoid

 GO Function (1)

AA Sequence

MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITAMKIPDSYQLS      1 - 70
PDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSSTMLGEGSQPDWPGGSRYDLD     71 - 140
EIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQNMARAIETQEGLGIEYDEDVVCDVCRSPEG    141 - 210
EDGNEMVFCDKCNVCVHQACYGILKVPTGSWLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCAL    211 - 280
WIPEVSIGCPEKMEPITKISHIPASRWALSCSLCKECTGTCIQCSMPSCVTAFHVTCAFDHGLEMRTILA    281 - 350
DNDEVKFKSFCQEHSDGGPRNEPTSEPTEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEPAEVAERLDLA    351 - 420
EALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVRNLCYMVTRRE    421 - 490
RTKHAICKLQEQIFHLQMKLIEQDLCRGLSTSFPIDGTFFNSWLAQSVQITAENMAMSEWPLNNGHREDP    491 - 560
APGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRLPAKKKPPPPPPQDGPGSRTTPDKAPKKTWG    561 - 630
QDAGSGKGGQGPPTRKPPRRTSSHLPSSPAAGDCPILATPESPPPLAPETPDEAASVAADSDVQVPGPAA    631 - 700
SPKPLGRLRPPRESKVTRRLPGARPDAGMGPPSAVAERPKVSLHFDTETDGYFSDGEMSDSDVEAEDGGV    701 - 770
QRGPREAGAEEVVRMGVLAS                                                      771 - 790
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16387653 2006 ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation.
More...