Property Summary

NCBI Gene PubMed Count 566
PubMed Score 439.73
PubTator Score 651.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
breast carcinoma 1614 4.00851035448049E-40
lung carcinoma 2844 3.72284563625197E-30
juvenile dermatomyositis 1189 4.26708625439486E-11
atypical teratoid / rhabdoid tumor 4369 1.6095713989169E-8
glioblastoma 5572 8.15367730743217E-8
osteosarcoma 7933 2.81053014426166E-7
pituitary cancer 1972 5.37925750216321E-7
Duchenne muscular dystrophy 602 2.25920788530451E-6
malignant mesothelioma 3163 2.70501059358507E-5
psoriasis 6685 3.07001134801653E-5
Amyotrophic Lateral Sclerosis 432 7.47556818139378E-5
ovarian cancer 8492 1.12270683899138E-4
group 4 medulloblastoma 1875 3.15746168286202E-4
dermatomyositis 967 4.47064652823301E-4
Pick disease 1893 4.6053923149748E-4
Atopic dermatitis 944 5.65149746388677E-4
pediatric high grade glioma 2712 7.71450554942863E-4
oligodendroglioma 2849 0.00136874986078079
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00193801022208524
interstitial cystitis 2299 0.00328017079943527
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00335231854690496
astrocytoma 1493 0.00354259590610375
Rheumatoid Arthritis 1171 0.00367002189841199
pancreatic cancer 2300 0.00460169534112275
pancreatic carcinoma 567 0.00460169534112285
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00462329491203313
ependymoma 2514 0.0062877670297501
non primary Sjogren syndrome sicca 840 0.0146549240445345
esophageal adenocarcinoma 737 0.0176010007179145
primitive neuroectodermal tumor 3031 0.0179599119960776
aldosterone-producing adenoma 664 0.0201587287676234
invasive ductal carcinoma 2950 0.0259305889318207
pilocytic astrocytoma 3086 0.0274041537760427
medulloblastoma, large-cell 6234 0.0356191723577509
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0395241915425597
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 5.955 3.0
Disease Target Count Z-score Confidence
Obesity 616 3.69 1.8

Expression

Gene

PANTHER Protein Class (1)

PDB

1JDH   1JPW   2GL7  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (622)

PMID Text
27058589 The T allele of TCF7L2 rs7903146 polymorphism was associated with susceptibility of gestational diabetes mellitus in overall population in white, Hispanic/Latino and Asian sub-groups. Meta-analysis.
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26986145 polymorphism may contribute to the risk of diabetic nephropathy
26934194 The strongest evidence of the TCF7L2 - Body Mass Index interaction was observed for rs7895307 SNP.
26914832 Despite limited sample size, the study indicates that rs7903146-T allele in TCF7L2 was associated with higher mean nocturnal glucose dependent on body composition, which might suggest that rs7902146 affects liver-specific aspects of glucose metabolism.
26681031 Meta-analysis revealed that the T allele of rs7903146 was also correlated with T2DM susceptibility.
26608632 Data indicate that triglycerides were significantly associated with the T risk allele of the transcription factor 7-like 2 (TCF7L2) gene.
26604685 this study demonstrates the presence of the rs7903146 polymorphism in the Iranian population, suggesting susceptibility to type 2 diabetes
26576435 Our meta-analysis indicated the association between TCF7L2 rs7903146 polymorphism and low plasma triglyceride (TG) level in subjects with type 2 diabetes.
26536002 Transcription factor 7-like 2 (TCF7L2) gene encodes the TCF-4 transcription factor, which forms a part of the Wnt signaling pathway.
More...

AA Sequence

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP      1 - 70
RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY     71 - 140
KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH    141 - 210
FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY    211 - 280
PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI    281 - 350
KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR    351 - 420
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYI    421 - 490
QGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEA    491 - 560
THKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE               561 - 619
//

Text Mined References (572)

PMID Year Title
27058589 2016 Transcription Factor 7-Like 2 (TCF7L2) rs7903146 Polymorphism as a Risk Factor for Gestational Diabetes Mellitus: A Meta-Analysis.
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26986145 2016 Association of the Transcription Factor 7 Like 2 (TCF7L2) Polymorphism With Diabetic Nephropathy Risk: A Meta-Analysis.
26934194 2016 Accumulating evidence for a role of TCF7L2 variants in bipolar disorder with elevated body mass index.
26914832 2016 Association between the rs7903146 Polymorphism in the TCF7L2 Gene and Parameters Derived with Continuous Glucose Monitoring in Individuals without Diabetes.
26681031 2015 Meta-analysis of the association between the rs7903146 polymorphism at the TCF7L2 locus and type 2 diabetes mellitus susceptibility.
26608632 2015 Association between the rs12255372 variant of the TCF7L2 gene and obesity in a Cameroonian population.
26604685 2015 Prevalence of the rs7903146C>T polymorphism in TCF7L2 gene for prediction of type 2 diabetes risk among Iranians of different ethnicities.
26576435 2015 The Protective Effect of Transcription Factor 7-Like 2 Risk Allele rs7903146 against Elevated Fasting Plasma Triglyceride in Type 2 Diabetes: A Meta-Analysis.
26536002 2015 Transcription Factor-7-Like 2 Gene Variants Affect the Metabolic Phenotypes of Polycystic Ovary Syndrome.
More...