Property Summary

NCBI Gene PubMed Count 566
Grant Count 103
R01 Count 43
Funding $12,325,646.62
PubMed Score 439.73
PubTator Score 651.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (52)

Disease Z-score Confidence
diabetes mellitus 1,663 5.955 3.0
Obesity 616 3.69 1.8
Metabolic syndrome X 155 3.12 1.6
Acquired metabolic disease 267 2.0
Adenocarcinoma 115
Amyotrophic Lateral Sclerosis 431
Atopic dermatitis 944
Bipolar Disorder 266
Breast cancer 3,094 2.0
Carcinoma 2,147 1.0
Cardiovascular system disease 194 1.0
Colonic Neoplasms 126
Colorectal Cancer 47
Colorectal Neoplasms 217
Diabetes Mellitus, Non-Insulin-Dependent 157
Duchenne muscular dystrophy 602
Hyperplasia 26
Juvenile arthritis 124
Malignant neoplasm of breast 63
Pick disease 1,893
Rheumatoid Arthritis 1,160
Type 2 diabetes mellitus 189 2.0
aldosterone-producing adenoma 664
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
dermatomyositis 933
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
non primary Sjogren syndrome sicca 840
oligodendroglioma 2,849
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
psoriasis 6,685

Expression

Gene

PANTHER Protein Class (1)

PDB

1JDH   1JPW   2GL7  

Gene RIF (623)

PMID Text
27058589 The T allele of TCF7L2 rs7903146 polymorphism was associated with susceptibility of gestational diabetes mellitus in overall population in white, Hispanic/Latino and Asian sub-groups. Meta-analysis.
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26986145 polymorphism may contribute to the risk of diabetic nephropathy
26934194 The strongest evidence of the TCF7L2 - Body Mass Index interaction was observed for rs7895307 SNP.
26914832 Despite limited sample size, the study indicates that rs7903146-T allele in TCF7L2 was associated with higher mean nocturnal glucose dependent on body composition, which might suggest that rs7902146 affects liver-specific aspects of glucose metabolism.
26681031 Meta-analysis revealed that the T allele of rs7903146 was also correlated with T2DM susceptibility.
26608632 Data indicate that triglycerides were significantly associated with the T risk allele of the transcription factor 7-like 2 (TCF7L2) gene.
26604685 this study demonstrates the presence of the rs7903146 polymorphism in the Iranian population, suggesting susceptibility to type 2 diabetes
26576435 Our meta-analysis indicated the association between TCF7L2 rs7903146 polymorphism and low plasma triglyceride (TG) level in subjects with type 2 diabetes.
26536002 Transcription factor 7-like 2 (TCF7L2) gene encodes the TCF-4 transcription factor, which forms a part of the Wnt signaling pathway.
More...

AA Sequence

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP      1 - 70
RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY     71 - 140
KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH    141 - 210
FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY    211 - 280
PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI    281 - 350
KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR    351 - 420
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYI    421 - 490
QGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEA    491 - 560
THKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE               561 - 619
//

Text Mined References (572)

PMID Year Title
27058589 2016 Transcription Factor 7-Like 2 (TCF7L2) rs7903146 Polymorphism as a Risk Factor for Gestational Diabetes Mellitus: A Meta-Analysis.
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26986145 2016 Association of the Transcription Factor 7 Like 2 (TCF7L2) Polymorphism With Diabetic Nephropathy Risk: A Meta-Analysis.
26934194 2016 Accumulating evidence for a role of TCF7L2 variants in bipolar disorder with elevated body mass index.
26914832 2016 Association between the rs7903146 Polymorphism in the TCF7L2 Gene and Parameters Derived with Continuous Glucose Monitoring in Individuals without Diabetes.
26681031 2015 Meta-analysis of the association between the rs7903146 polymorphism at the TCF7L2 locus and type 2 diabetes mellitus susceptibility.
26608632 2015 Association between the rs12255372 variant of the TCF7L2 gene and obesity in a Cameroonian population.
26604685 2015 Prevalence of the rs7903146C>T polymorphism in TCF7L2 gene for prediction of type 2 diabetes risk among Iranians of different ethnicities.
26576435 2015 The Protective Effect of Transcription Factor 7-Like 2 Risk Allele rs7903146 against Elevated Fasting Plasma Triglyceride in Type 2 Diabetes: A Meta-Analysis.
26536002 2015 Transcription Factor-7-Like 2 Gene Variants Affect the Metabolic Phenotypes of Polycystic Ovary Syndrome.
More...