Property Summary

NCBI Gene PubMed Count 607
PubMed Score 474.23
PubTator Score 651.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 1.0
Disease Target Count Z-score Confidence
Gestational diabetes 26 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 5.996 3.0
Disease Target Count Z-score Confidence
Obesity 678 3.745 1.9
Hyperglycemia 137 3.021 1.5

Expression

  Differential Expression (36)

Disease log2 FC p
Breast cancer -1.600 1.1e-07
aldosterone-producing adenoma -1.014 2.0e-02
Amyotrophic lateral sclerosis 1.016 7.5e-05
astrocytic glioma 1.700 6.9e-03
Astrocytoma, Pilocytic 1.600 2.1e-02
Atopic dermatitis -1.200 5.7e-04
atypical teratoid / rhabdoid tumor 1.300 6.8e-07
autosomal dominant Emery-Dreifuss muscul... 1.296 9.7e-03
breast carcinoma -1.100 1.1e-03
dermatomyositis 1.800 4.5e-04
Duchenne muscular dystrophy 1.373 2.3e-06
ependymoma 2.100 6.3e-03
esophageal adenocarcinoma 1.300 1.8e-02
glioblastoma 1.600 4.9e-06
group 4 medulloblastoma -2.500 3.2e-04
interstitial cystitis -1.100 3.3e-03
intraductal papillary-mucinous adenoma (... 1.200 1.4e-03
intraductal papillary-mucinous carcinoma... 1.100 6.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 2.8e-03
invasive ductal carcinoma -1.032 2.1e-03
juvenile dermatomyositis 1.273 4.3e-11
lung carcinoma -2.200 3.7e-30
malignant mesothelioma 1.200 5.5e-05
medulloblastoma, large-cell -1.600 3.6e-02
non primary Sjogren syndrome sicca -1.200 1.5e-02
oligodendroglioma 1.900 1.4e-03
osteosarcoma 1.039 2.5e-02
ovarian cancer -1.500 2.6e-06
pancreatic cancer -1.300 4.6e-03
pancreatic carcinoma -1.300 4.6e-03
pediatric high grade glioma 2.300 7.7e-04
Pick disease 1.300 4.6e-04
pituitary cancer -1.400 2.3e-04
primitive neuroectodermal tumor 2.600 1.8e-02
psoriasis -1.100 3.4e-07
Rheumatoid arthritis 2.400 3.7e-03

Protein-protein Interaction (3)

Gene RIF (658)

AA Sequence

MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSSDSEAERRPPP      1 - 70
RSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGSLSPTARTLHFQSGSTHYSAY     71 - 140
KTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSPAHIVSNKVPVVQHPHHVHPLTPLITYSNEH    141 - 210
FTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPY    211 - 280
PTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHI    281 - 350
KKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR    351 - 420
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCVRYI    421 - 490
QGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLSMMPPPPALLLAEA    491 - 560
THKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQPQPLSLVTKSLE               561 - 619
//

Text Mined References (615)

PMID Year Title