Property Summary

NCBI Gene PubMed Count 58
Grant Count 43
R01 Count 23
Funding $2,835,420.55
PubMed Score 127.08
PubTator Score 102.85

Knowledge Summary

Patent (15,528)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.400 0.001

Gene RIF (40)

PMID Text
26837804 These findings indicate that the A563T variation induces structural, dynamical, and electrostatic changes in the TRPV5 pore, providing structural insight into the functional alterations associated with the A563T variation.
26089600 Data found that a TRPV5 polymorphism (rs4236480) was observed to be associated with stone multiplicity of calcium nephrolithiasis, as the risk of stone multiplicity was higher in patients with the TT+CT genotype than in patients with the CC genotype
25378396 Klotho up-regulates TRPV5 from both the inside and outside of cells.
25164318 High TRPV5 expression is aassociated with adenoma of parathyroid glands.
25139832 Upregulating the expression of TRPV5 can be utilized to manipulate transmembrane Ca2+ transport, and may serve as an alternative for the treatment of Ca2+ balance-related diseases.
24761864 Decreased expression of TRPV5 is associated with non-small cell lung cancer.
24592736 these data showed that TRPV5/TRPV6 in human lymphocytes are functionally active, and their activity is associated with proliferative status of blood cells.
23970553 Data indicate that transient receptor potential vanilloid type 5 (TRPV5) plasma membrane retention is regulated via lipid rafts.
23968883 These results suggest that TRPV5 and TRPV6 are crucial gates controlling cadmium and zinc levels in the human body.
23469151 TRPML3 and TRPV5 heteromers could have a biological function
More...

AA Sequence

MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTC      1 - 70
DVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTALHIAVVNQNVNLVRALLTRR     71 - 140
ASVSARATGTAFRRSPRNLIYFGEHPLSFAACVNSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKT    141 - 210
FACQMYNLLLSYDGHGDHLQPLDLVPNHQGLTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDL    211 - 280
TEIDSWGEELSFLELVVSSDKREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYR    281 - 350
PLKFRGGNRTHSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI    351 - 420
LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTIMIQKMIFGDL    421 - 490
MRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTVIDAPANYDVDLPFMFSIVNF    491 - 560
AFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVATTVMLERKLPRCLWPRSGICGCEFGLGDRWF    561 - 630
LRVENHNDQNPLRVLRYVEVFKNSDKEDDQEHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRG    631 - 700
WEILRQNTLGHLNLGLNLSEGDGEEVYHF                                             701 - 729
//

Text Mined References (61)

PMID Year Title
26837804 2016 Molecular Modeling of the Structural and Dynamical Changes in Calcium Channel TRPV5 Induced by the African-Specific A563T Variation.
26089600 2015 A Single Nucleotide Polymorphism (rs4236480) in TRPV5 Calcium Channel Gene Is Associated with Stone Multiplicity in Calcium Nephrolithiasis Patients.
25378396 2014 Klotho up-regulates renal calcium channel transient receptor potential vanilloid 5 (TRPV5) by intra- and extracellular N-glycosylation-dependent mechanisms.
25164318 2014 First evidence of TRPV5 and TRPV6 channels in human parathyroid glands: possible involvement in neoplastic transformation.
25139832 2014 Induction of TRPV5 expression by small activating RNA targeting gene promoter as a novel approach to regulate cellular calcium transportation.
24761864 2014 Expression and prognostic roles of TRPV5 and TRPV6 in non-small cell lung cancer after curative resection.
24592736 2013 [The functional characteristics oF TRPV5 and TRPV6 channels in normal and transformed human blood lymphocytes].
23970553 2013 The epithelial calcium channel TRPV5 is regulated differentially by klotho and sialidase.
23968883 2013 Human TRPV5 and TRPV6: key players in cadmium and zinc toxicity.
23469151 2013 A novel ion channel formed by interaction of TRPML3 with TRPV5.
More...