Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.17
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (2)

AA Sequence

MAFHEMQAHKNALGTSGEQQAADITGPTPHQGGWKQVEQSRSQVQAIGEKVSLAQAKIEKIKGSKKAIKV      1 - 70
FSSAKYPAPERLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKLKDFPVCVSTKPEPEDDAEE     71 - 140
GLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQV    141 - 210
PENYFYVPDLGQVPEIDVPSYLPDLPSIANDLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKADLQD    211 - 280
GVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDGSSSASPSVQGAPREVVDPSGGWATLLES    281 - 350
IRQAGGIGKAKLRSMKERKLEKKKQKEQEQVRATSQGGHLMSDLFNKLVMRRKGISGKGPGAGEGPGGAF    351 - 420
ARVSDSIPPVPPPQQPQAEEDEDDWES                                               421 - 447
//

Text Mined References (18)

PMID Year Title