Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.80
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q9NQA3 A6NGF1 Q8N305
Symbols WASH
FAM39A
CXYorf1

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
20498093 show that WASH functions in cells within a 500 kDa core complex containing Strumpellin, FAM21, KIAA1033 (SWIP), and CCDC53.
20308062 WASH is a bimodular protein and a component of the BLOC-1 complex in which the C terminus is involved in Arp2/3-mediated actin nucleation, whereas the N-terminal portion is required for its regulation and localization in the cells

AA Sequence

MAFHEMQAHKNALGTSGEQQAADITGPTPHQGGWKQVEQSRSQVQAIGEKVSLAQAKIEKIKGSKKAIKV      1 - 70
FSSAKYPAPERLQEYGSIFTGAQDPGLQRRPRHRIQSKHRPLDERALQEKLKDFPVCVSTKPEPEDDAEE     71 - 140
GLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVTKTHVMLGAETEEKLFDAPLSISKREQLEQQV    141 - 210
PENYFYVPDLGQVPEIDVPSYLPDLPSIANDLMYSADLGPGIAPSAPGTIPELPTFHTEVAEPLKADLQD    211 - 280
GVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQDDGSSSASPSVQGAPREVVDPSGGWATLLES    281 - 350
IRQAGGIGKAKLRSMKERKLEKKKQKEQEQVRATSQGGHLMSDLFNKLVMRRKGISGKGPGAGEGPGGAF    351 - 420
ARVSDSIPPVPPPQQPQAEEDEDDWES                                               421 - 447
//

Text Mined References (18)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20498093 2010 WASH and WAVE actin regulators of the Wiskott-Aldrich syndrome protein (WASP) family are controlled by analogous structurally related complexes.
20308062 2010 Functional characterization of Wiskott-Aldrich syndrome protein and scar homolog (WASH), a bi-modular nucleation-promoting factor able to interact with biogenesis of lysosome-related organelle subunit 2 (BLOS2) and gamma-tubulin.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18159949 2007 Human subtelomeric WASH genes encode a new subclass of the WASP family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
More...