Property Summary

NCBI Gene PubMed Count 27
PubMed Score 84.03
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease -1.174 5.2e-03
colon cancer -1.800 1.8e-03
lung carcinoma 1.900 8.4e-07
nephrosclerosis -1.084 6.1e-03
osteosarcoma 1.066 2.2e-05
ovarian cancer 1.200 1.1e-07
pancreatic cancer -1.100 1.4e-02
primary pancreatic ductal adenocarcinoma -1.158 8.8e-03
ulcerative colitis -1.500 3.8e-03

Gene RIF (5)

AA Sequence

MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFED      1 - 70
ELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFV     71 - 140
GGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHG    141 - 210
IAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAV    211 - 280
EAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAP    281 - 350
QTYAAIPSLHFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED    351 - 420
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALAS    421 - 490
QNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQL    491 - 560
KQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF                                        561 - 594
//

Text Mined References (29)

PMID Year Title