Property Summary

NCBI Gene PubMed Count 26
PubMed Score 80.49
PubTator Score 15.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 1.06328215636597E-7
lung carcinoma 2844 8.44613863338098E-7
osteosarcoma 7933 2.19315891928417E-5
ulcerative colitis 2087 4.473907720522E-4
colon cancer 1475 0.00176836163983863
active Crohn's disease 918 0.00518201332521782
nephrosclerosis 329 0.00611976243093612
primary pancreatic ductal adenocarcinoma 1271 0.00883640385193163
pancreatic cancer 2300 0.0142121204733022
Disease Target Count Z-score Confidence
Gout 93 0.0 2.0
Disease Target Count Z-score Confidence
Amblyopia 24 4.569 2.3
Anisometropia 16 4.333 2.2

Expression

  Differential Expression (9)

Disease log2 FC p
nephrosclerosis -1.084 0.006
osteosarcoma 1.066 0.000
primary pancreatic ductal adenocarcinoma -1.158 0.009
colon cancer -1.800 0.002
active Crohn's disease -1.174 0.005
pancreatic cancer -1.100 0.014
lung carcinoma 1.900 0.000
ulcerative colitis -2.300 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9NQ94 A1L4F2 A8K7G7 B7ZM14 Q5SZQ0 Q9NQ93 Q9NQX8 Q9NQX9 Q9NXC9 Q9NZD3
Symbols ACF
ASP
ACF64
ACF65
APOBEC1CF

Gene

PDB

2CPD  

  Ortholog (14)

Gene RIF (4)

PMID Text
25902538 hnRNP K and hnRNP L may serve as A1CF-like cofactors in AID-mediated class switch recombination and somatic hypermutation
19932086 The data presented in this report suggested that similar regulatory mechanisms controlling the functional interaction of APOBEC-1 with ACF might be operational during enterocyte differentiation.
16055734 ACF plays a crucial role, which is independent of apobec-1 expression, in cell survival, particularly during early embryonic development
15148397 results suggested both AID and APOBEC-1 are equally likely to bind single-stranded DNA or RNA, which has implications for the identification of natural AID targets

AA Sequence

MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFED      1 - 70
ELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFV     71 - 140
GGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHG    141 - 210
IAVDWAEPEVEVDEDTMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAV    211 - 280
EAMKALNGKVLDGSPIEVTLAKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAP    281 - 350
QTYAAIPSLHFPATKGHLSNRAIIRAPSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKRED    351 - 420
KLYDILPGMELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALAS    421 - 490
QNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQL    491 - 560
KQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF                                        561 - 594
//

Text Mined References (28)

PMID Year Title
25902538 2015 Identification of DNA cleavage- and recombination-specific hnRNP cofactors for activation-induced cytidine deaminase.
25416956 2014 A proteome-scale map of the human interactome network.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
19932086 2010 The expression of apoB mRNA editing factors is not the sole determinant for the induction of editing in differentiating Caco-2 cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16055734 2005 Targeted deletion of the murine apobec-1 complementation factor (acf) gene results in embryonic lethality.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...