Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.63
PubTator Score 2.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.175 0.012
cystic fibrosis 1.029 0.000
sonic hedgehog group medulloblastoma -1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q9NQ92 A6NP14 E1P656 Q96EF5 Q96P75
Symbols TTP1
COPR5
C17orf79
HSA272196

Gene

AA Sequence

MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQSIPNDSPARG      1 - 70
EGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSELKADQGNPYDADDIQESISQE     71 - 140
LKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFDDAED                              141 - 184
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22193545 2012 The histone- and PRMT5-associated protein COPR5 is required for myogenic differentiation.
18404153 2008 The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10843809 2000 A common set of at least 11 functional genes is lost in the majority of NF1 patients with gross deletions.