Property Summary

NCBI Gene PubMed Count 23
PubMed Score 105.82
PubTator Score 45.50

Knowledge Summary

Patent (1,177)

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 2.400 3.0e-05
lung adenocarcinoma -1.500 1.6e-16
lung cancer -1.900 5.7e-04
lung carcinoma -1.400 3.0e-09
medulloblastoma, large-cell 1.700 1.0e-03
non-small cell lung carcinoma -1.700 7.3e-37

Gene RIF (12)

AA Sequence

MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPCGGESTRSSSV      1 - 70
INNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGP     71 - 140
GDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENKSQGSIFVRIHAPWQVLAREAEFLKIKVPTK    141 - 210
KEMYEIKAGGSIAKKFSAALQKLSSHLQPRVPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSR    211 - 280
IVHEILKRTACSRANNTMGINSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPID    281 - 350
LIRKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY    351 - 420
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERAQEHSRPEY    421 - 490
ETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYR    491 - 560
ITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLL    561 - 630
KFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGV    631 - 700
PKLKKLFRKLKDETEAGETDSAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFA    701 - 770
LLNNVIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH    771 - 840
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWFILSARLAFV    841 - 910
IIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAA    911 - 980
SSAPSGQSQLGSMMSSGSQHTNV                                                   981 - 1003
//

Text Mined References (29)

PMID Year Title