Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 10
Funding $796,722.72
PubMed Score 89.24
PubTator Score 45.50

Knowledge Summary

Patent (1,177)

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell 1.700 0.001
lung cancer -1.900 0.001
lung adenocarcinoma -1.600 0.000
group 3 medulloblastoma 2.400 0.000
lung carcinoma -1.400 0.000
non-small cell lung carcinoma -1.700 0.000

Gene RIF (11)

PMID Text
26862169 data revealed prominently increased autoantibody reactivity against the chloride-channel protein anoctamin 2 (ANO2) in multiple sclerosis cases compared with controls
25635880 Olfactory function impairment in Italian patients with type 3 von Willebrand disease with partial deletion of TMEM16B.
25489088 results reveal multidimensional regulation of TMEM16A/16B by preassociated apoCaM and introduce ChIMP as a versatile tool to probe the macromolecular complex and function of Ca(2+)-activated chloride channels
24928056 ANO2 is present in human myometrium.
23570556 The third intracellular loop of TMEM16B is the site involved in calcium ion sensitivity, whereas the C-terminal part affects the rate of transition between the open and the closed state of the channel.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19561302 Ano2 likely amplifies the odor-induced generator potential in olfactory sensory neuron cilia by sensing elevated calcium levels, permitting the outward flow of chloride ions from the cell.
19474308 This study suggested that TMEM16B to be a strong candidate for the long sought-after Ca(2+)-dependent chloride channel in the photoreceptor synapse.
19165232 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17371490 VWF and TMEM16B deletions may have a role in severe von Willebrand disease type 3
More...

AA Sequence

MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPCGGESTRSSSV      1 - 70
INNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPGHSLAIVSNGETGKEPHAGGP     71 - 140
GDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENKSQGSIFVRIHAPWQVLAREAEFLKIKVPTK    141 - 210
KEMYEIKAGGSIAKKFSAALQKLSSHLQPRVPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSR    211 - 280
IVHEILKRTACSRANNTMGINSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPID    281 - 350
LIRKYFGEKIGLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY    351 - 420
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEERAQEHSRPEY    421 - 490
ETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIVFGVIVYR    491 - 560
ITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVPKTEQTFEERLILKAFLL    561 - 630
KFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGV    631 - 700
PKLKKLFRKLKDETEAGETDSAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFA    701 - 770
LLNNVIEVRLDAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH    771 - 840
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWFILSARLAFV    841 - 910
IIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPALRSPGGGDRSRSRAA    911 - 980
SSAPSGQSQLGSMMSSGSQHTNV                                                   981 - 1003
//

Text Mined References (28)

PMID Year Title
26862169 2016 Anoctamin 2 identified as an autoimmune target in multiple sclerosis.
25635880 2015 Assessment of the olfactory function in Italian patients with type 3 von Willebrand disease caused by a homozygous 253 Kb deletion involving VWF and TMEM16B/ANO2.
25489088 2014 Preassociated apocalmodulin mediates Ca2+-dependent sensitization of activation and inactivation of TMEM16A/16B Ca2+-gated Cl- channels.
24928056 2014 Calcium-activated chloride channels anoctamin 1 and 2 promote murine uterine smooth muscle contractility.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
23570556 2013 TMEM16A-TMEM16B chimaeras to investigate the structure-function relationship of calcium-activated chloride channels.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
More...