Property Summary

NCBI Gene PubMed Count 47
PubMed Score 58.91
PubTator Score 49.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.556 3.4e-02
active ulcerative colitis 1.268 2.5e-02
astrocytic glioma -1.400 3.2e-02
cutaneous lupus erythematosus 1.700 2.2e-04
ductal carcinoma in situ 1.300 2.9e-03
glioblastoma 2.200 8.9e-04
group 3 medulloblastoma 2.200 4.7e-04
interstitial cystitis 1.600 2.3e-03
nasopharyngeal carcinoma 1.300 1.4e-03
ovarian cancer 1.700 8.0e-04
psoriasis 1.600 6.0e-08

Gene RIF (33)

AA Sequence

MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL      1 - 70
ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC     71 - 140
QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL    141 - 210
TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR              211 - 270
//

Text Mined References (51)

PMID Year Title