Property Summary

NCBI Gene PubMed Count 40
Grant Count 13
R01 Count 11
Funding $1,942,646.84
PubMed Score 51.07
PubTator Score 49.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 0.032
psoriasis 2.000 0.000
cutaneous lupus erythematosus 1.700 0.000
glioblastoma 2.200 0.001
active Crohn's disease 1.556 0.034
active ulcerative colitis 1.268 0.025
interstitial cystitis 1.600 0.002
group 4 medulloblastoma 2.300 0.000
nasopharyngeal carcinoma 1.300 0.001
ductal carcinoma in situ 1.300 0.003
ovarian cancer 1.700 0.001

Gene RIF (26)

PMID Text
26700591 Geranylgeranoic acid induced upregulation of the TIGAR gene, which might inhibit the glycolysis in HuH-7 cells with p53 mutation.
26691054 TIGAR knockdown reduced tumor growth rate.
26675982 TIGAR expression may be used as a bio-marker for detection of colorectal cancer and can be used as a target for developing therapeutics for the treatment of colorectal cancer.
26191173 TIGAR over-expression could diminish the radiosensitivity of Hs 917.T cells, and the autophagy level induced by ionizing radiation (IR) was also decreased by TIGAR transfection.
25928429 The Cdk5-AMT signal pathway involved in regulation of DDR by TIGAR.
25660220 miR-144 targeted TIGAR, inhibited proliferation, enhanced apoptosis, and increased autophagy in A549 and H460 cells
25085248 Results revealed that TIGAR inhibits both apoptosis and autophagy.
24632713 Data show targeting MUC1-C is synergistic with bortezomib (BTZ) in suppressing p53-inducible regulator of glycolysis and apoptosis (TIGAR)-mediated regulation of reactive oxygen species levels for combining GO-203 with BTZ in BTZ resistance.
24423178 The kinetic properties and the structural similarity of the best substrates of TIGAR make it unlikely that TIGAR modulates cellular fructose 2,6-bisphosphate levels directly.
24363807 TIGAR is correlated with maximal standardized uptake value on FDG-PET and survival in non-small cell lung cancer.
More...

AA Sequence

MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL      1 - 70
ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC     71 - 140
QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL    141 - 210
TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR              211 - 270
//

Text Mined References (44)

PMID Year Title
26700591 2015 Upregulation of energy metabolism-related, p53-target TIGAR and SCO2 in HuH-7 cells with p53 mutation by geranylgeranoic acid treatment.
26691054 2016 Oncogenic role of the TP53-induced glycolysis and apoptosis regulator in nasopharyngeal carcinoma through NF-?B pathway modulation.
26675982 2016 Identification of the TP53-induced glycolysis and apoptosis regulator in various stages of colorectal cancer patients.
26191173 2015 TIGAR overexpression diminishes radiosensitivity of parotid gland fibroblast cells and inhibits IR-induced cell autophagy.
25928429 2015 TIGAR regulates DNA damage and repair through pentosephosphate pathway and Cdk5-ATM pathway.
25660220 2015 MiR-144 inhibits proliferation and induces apoptosis and autophagy in lung cancer cells by targeting TIGAR.
25085248 2014 TIGAR has a dual role in cancer cell survival through regulating apoptosis and autophagy.
24632713 2014 Targeting MUC1-C is synergistic with bortezomib in downregulating TIGAR and inducing ROS-mediated myeloma cell death.
24423178 2014 Identification of TP53-induced glycolysis and apoptosis regulator (TIGAR) as the phosphoglycolate-independent 2,3-bisphosphoglycerate phosphatase.
24363807 2013 TIGAR is correlated with maximal standardized uptake value on FDG-PET and survival in non-small cell lung cancer.
More...