Property Summary

NCBI Gene PubMed Count 19
Grant Count 29
R01 Count 13
Funding $879,043.84
PubMed Score 91.47
PubTator Score 57.76

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
25217524 repression of TGFbeta signaling by Notch acting through HEYL may promote initiation of breast cancer
21454491 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21290414 In this study, we analyzed the effects of HESR1, -2, and -3 on DAT1 expression in human neuroblastoma SH-SY5Y cells

AA Sequence

MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRINSSLSELRRLV      1 - 70
PTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSS     71 - 140
RADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFFHSCPGLPALSNQLAILGRVPSPVLPGVSSP    141 - 210
AYPIPALRTAPLRRATGIILPARRNVLPSRGASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSS    211 - 280
PTPPGPTGSAAYVAVPTPNSSSPGPAGRPAGAMLYHSWVSEITEIGAF                          281 - 328
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25217524 2014 The Notch pathway inhibits TGF? signaling in breast cancer through HEYL-mediated crosstalk.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21454491 2011 Repression of androgen receptor activity by HEYL, a third member of the Hairy/Enhancer-of-split-related family of Notch effectors.
21290414 2011 Differential effects of the HESR/HEY transcription factor family on dopamine transporter reporter gene expression via variable number of tandem repeats.
17611704 2007 Integrative genomic analyses on HES/HEY family: Notch-independent HES1, HES3 transcription in undifferentiated ES cells, and Notch-dependent HES1, HES5, HEY1, HEY2, HEYL transcription in fetal tissues, adult tissues, or cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16165016 2005 Hesr, a mediator of the Notch signaling, functions in heart and vessel development.
More...