Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $706,785.5
PubMed Score 11.67
PubTator Score 7.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
astrocytic glioma -2.700 0.004
ependymoma -1.700 0.045
oligodendroglioma -2.400 0.016
psoriasis -1.800 0.002
glioblastoma multiforme -1.300 0.000
adrenocortical carcinoma 1.134 0.028
tuberculosis -2.400 0.000
intraductal papillary-mucinous carcinoma... 1.900 0.002
intraductal papillary-mucinous neoplasm ... 2.700 0.000
lung cancer -1.400 0.010
group 3 medulloblastoma 2.600 0.000
pilocytic astrocytoma -2.800 0.000
severe Alzheimer's disease -1.427 0.031
Pick disease -1.500 0.017
ductal carcinoma in situ 1.500 0.044
ulcerative colitis -2.100 0.000

Synonym

Accession Q9NQ86 A1L3Z1 A6NDD0 B7Z3V4 B7ZAV7 E9PFI8 Q0P5Z9
Symbols RNF98
HAPRIN
RBCC728

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
23333304 HIV-1 Vif downregulates the expression of tripartite motif containing 36 (TRIM36) in Vif-expression T cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19232519 TRIM36 has a ubiquitin ligase activity and interacts with centromere protein-H, potentially associated with chromosome segregation and its excess may cause chromosomal instability.
15955891 molecular cloning and characterization of a human haprin ortholog.
15145053 The overexpression of the TRIM36 in the vast majority of prostate cancer suggest that this gene might be involved in the prostate tumorigenesis.

AA Sequence

MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLTLDDSFND      1 - 70
VGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEHDVDLGERGINGLFRNFTLET     71 - 140
IVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKIL    141 - 210
MCPEHETERINMYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISE    211 - 280
LNLLMKETECNGERAKEEAITHFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVG    281 - 350
YAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP    351 - 420
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRA    421 - 490
YKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESRAGFNLLLAAERIQVGYYTSL    491 - 560
DYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEWLRSPRDAVSPRYEQDSGHDSGSEDACFDSS    561 - 630
QPFTLVTIGMQKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVDFYDMDQMKCLYERQVDCSHTLY    631 - 700
PAFALMGSGGIQLEEPITAKYLEYQEDM                                              701 - 728
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19232519 2009 TRIM36 interacts with the kinetochore protein CENP-H and delays cell cycle progression.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
15955891 Identification of human HAPRIN potentially involved in the acrosome reaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15145053 2004 Cloning and characterisation of the RBCC728/TRIM36 zinc-binding protein from the tumor suppressor gene region at chromosome 5q22.3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...