Property Summary

NCBI Gene PubMed Count 11
PubMed Score 12.12
PubTator Score 7.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adrenocortical carcinoma 1.134 2.8e-02
astrocytic glioma -2.700 4.5e-03
Astrocytoma, Pilocytic -2.800 2.1e-07
ductal carcinoma in situ 1.500 4.4e-02
ependymoma -1.700 4.5e-02
glioblastoma -1.300 1.4e-02
group 3 medulloblastoma 1.900 3.8e-02
intraductal papillary-mucinous carcinoma... 1.900 2.1e-03
intraductal papillary-mucinous neoplasm ... 2.700 3.2e-04
lung cancer -1.400 9.8e-03
malignant mesothelioma -2.100 8.1e-08
oligodendroglioma -2.400 1.6e-02
Pick disease -1.500 1.7e-02
psoriasis -1.800 1.9e-03
severe Alzheimer's disease -1.427 3.1e-02
tuberculosis -2.400 9.6e-08
ulcerative colitis -2.100 1.1e-05

Gene RIF (8)

AA Sequence

MSESGEMSEFGYIMELIAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKELLLTLDDSFND      1 - 70
VGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTVFPCPGCEHDVDLGERGINGLFRNFTLET     71 - 140
IVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCNECFKIHHPWGTIKAQHEYVGPTTNFRPKIL    141 - 210
MCPEHETERINMYCELCRRPVCHLCKLGGNHANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISE    211 - 280
LNLLMKETECNGERAKEEAITHFEKLFEVLEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVG    281 - 350
YAQEVLKETDQSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP    351 - 420
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINRDDEMSWNEIEVCGTSKIIQDLENSSTYAFRVRA    421 - 490
YKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESRAGFNLLLAAERIQVGYYTSL    491 - 560
DYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEWLRSPRDAVSPRYEQDSGHDSGSEDACFDSS    561 - 630
QPFTLVTIGMQKFFIPKSPTSSNEPENRVLPMPTSIGIFLDCDKGKVDFYDMDQMKCLYERQVDCSHTLY    631 - 700
PAFALMGSGGIQLEEPITAKYLEYQEDM                                              701 - 728
//

Text Mined References (14)

PMID Year Title