Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.85
PubTator Score 3.10

Knowledge Summary

Patent (2,894)

Expression

  Differential Expression (5)

Synonym

Accession Q9NQ84 B5BUN4 Q2NL85 Q9NZG5
Symbols RAIG3
RAIG-3

Gene

PANTHER Protein Class (2)

  TechDev Info (2)

Bryan Roth functional assay
Steve Finkbeiner Neuron specific phenotypes being screened

AA Sequence

MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTII      1 - 70
LVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFA     71 - 140
LNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFV    141 - 210
MALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTL    211 - 280
AIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVA    281 - 350
AKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ    351 - 420
AATPPKDGKNSQVFRNPYVWD                                                     421 - 441
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
More...