Property Summary

NCBI Gene PubMed Count 14
PubMed Score 1.85
PubTator Score 3.10

Knowledge Summary

Patent (2,894)

Expression

  Differential Expression (5)

Disease log2 FC p
esophageal adenocarcinoma 1.100 1.8e-02
pancreatic ductal adenocarcinoma liver m... -1.278 9.8e-04
group 4 medulloblastoma -1.100 1.3e-02
aldosterone-producing adenoma 1.071 2.2e-02
gastric carcinoma -2.200 3.3e-02

AA Sequence

MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTII      1 - 70
LVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFA     71 - 140
LNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFV    141 - 210
MALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTL    211 - 280
AIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVA    281 - 350
AKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ    351 - 420
AATPPKDGKNSQVFRNPYVWD                                                     421 - 441
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11311935 2001 Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D.
10945465 2000 Molecular cloning and characterization of two novel retinoic acid-inducible orphan G-protein-coupled receptors (GPRC5B and GPRC5C).
10783259 2000 Sequence and expression pattern of a novel human orphan G-protein-coupled receptor, GPRC5B, a family C receptor with a short amino-terminal domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.