Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $477,500
PubMed Score 32.32
PubTator Score 16.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.500 0.005
oligodendroglioma 1.100 0.008
glioblastoma -2.600 0.000
ependymoma -2.500 0.000
group 3 medulloblastoma -2.500 0.001
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -2.700 0.002
non-small cell lung cancer -1.768 0.000
lung cancer -4.100 0.000
interstitial cystitis -3.400 0.000
lung adenocarcinoma -3.900 0.000
adult high grade glioma -2.100 0.000
pilocytic astrocytoma -1.700 0.000
lung carcinoma -1.800 0.000
ovarian cancer 1.400 0.000

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17602227 in bone fracture patients, 12 proteins were related to bone/cartilage metabolism, including: TGF-beta induced protein IG-H(3), cartilage acidic protein 1, procollagen C proteinase enhancer protein and TGF-beta receptor III.
17074475 CRTAC1 acquired an alternate last exon from the tail-to-tail oriented neighbouring gene in humans resulting in the glycosylated isoform CRTAC1-A which represents a new extracellular matrix molecule of articular cartilage.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPSADPGMSRMLPFLLLLWFLPITEGSQRAEPMFTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFE      1 - 70
IVVAGYNGPNLVLKYDRAQKRLVNIAVDERSSPYYALRDRQGNAIGVTACDIDGDGREEIYFLNTNNAFS     71 - 140
GVATYTDKLFKFRNNRWEDILSDEVNVARGVASLFAGRSVACVDRKGSGRYSIYIANYAYGNVGPDALIE    141 - 210
MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAA    211 - 280
ASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVIT    281 - 350
ADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDL    351 - 420
ILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPV    421 - 490
AHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDT    491 - 560
NECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAA    561 - 630
AAAGAATAAPVLVDGDLNLGSVVKESCEPSC                                           631 - 661
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
20803292 2011 Bone morphogenetic protein-7 promotes chondrogenesis in human amniotic epithelial cells.
20694148 2010 A genome-wide association study of the metabolic syndrome in Indian Asian men.
20382749 2010 Regulated gene expression in cultured type II cells of adult human lung.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20171266 2010 CRTAC1 homolog proteins are conserved from cyanobacteria to man and secreted by the teleost fish pituitary gland.
19952464 2010 Genes up- or down-regulated by high calcium medium in parathyroid tissue explants from patients with primary hyperparathyroidism.
19738042 2009 Glomus tumors in neurofibromatosis type 1: genetic, functional, and clinical evidence of a novel association.
17602227 2007 Detection of bone and cartilage-related proteins in plasma of patients with a bone fracture using liquid chromatography-mass spectrometry.
More...