Property Summary

NCBI Gene PubMed Count 30
Grant Count 55
R01 Count 25
Funding $3,642,739.04
PubMed Score 141.14
PubTator Score 73.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
primitive neuroectodermal tumor -1.100 0.005

Gene RIF (19)

PMID Text
23570370 Results indicate an association of MEPE gene inactivation with decreased survival after DNA damage.
22341070 results indicated that MEPE appeared to play an important positive role in proliferation and osteogenesis differentiation of DPCs through interaction with downstream signals.
21779381 Among migraineurs with aura rs7698623 in MEPE (OR = 6.37; 95% CI 3.15-12.90; p = 2.7x10(-7)) and rs4975709 in IRX4 (OR = 5.06; 95% CI 2.66-9.62; p = 7.7x10(-7)) appeared to be associated with ischemic stroke.
21739089 MEPE or the MEPE-derived acidic serine aspartate-rich MEPE-associated motif peptide may contribute to decreased bone mineralization in Oncogenic osteomalacia patients.
21312267 Sclerostin acts through regulation of the PHEX/MEPE axis at the preosteocyte stage and serves as a master regulator of physiologic bone mineralization.
20581062 These results suggest that abnormal MEPE cleavage occurs when PHEX activity is deficient in humans.
19998030 This study demonstrates the importance of posttranslational modification for the site-specific activity of MEPE and its ASARM peptide.
19679205 The patterns of expression of FGF-23, MEPE, and DMP1 differ markedly in trabecular bone, suggesting that individual osteocytes may have specialized functions.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19031789 MEPE may play a regulatory role in periodontal ligament cell osteogenic differentiation.
More...

AA Sequence

MRVFCVGLLLFSVTWAAPTFQPQTEKTKQSCVEEQRQEEKNKDNIGFHHLGKRINQELSSKENIVQERKK      1 - 70
DLSLSEASENKGSSKSQNYFTNRQRLNKEYSISNKENTHNGLRMSIYPKSTGNKGFEDGDDAISKLHDQE     71 - 140
EYGAALIRNNMQHIMGPVTAIKLLGEENKENTPRNVLNIIPASMNYAKAHSKDKKKPQRDSQAQKSPVKS    141 - 210
KSTHRIQHNIDYLKHLSKVKKIPSDFEGSGYTDLQERGDNDISPFSGDGQPFKDIPGKGEATGPDLEGKD    211 - 280
IQTGFAGPSEAESTHLDTKKPGYNEIPEREENGGNTIGTRDETAKEADAVDVSLVEGSNDIMGSTNFKEL    281 - 350
PGREGNRVDAGSQNAHQGKVEFHYPPAPSKEKRKEGSSDAAESTNYNEIPKNGKGSTRKGVDHSNRNQAT    351 - 420
LNEKQRFPSKGKSQGLPIPSRGLDNEIKNEMDSFNGPSHENIITHGRKYHYVPHRQNNSTRNKGMPQGKG    421 - 490
SWGRQPHSNRRFSSRRRDDSSESSDSGSSSESDGD                                       491 - 525
//

Text Mined References (33)

PMID Year Title
24945404 2014 Phenotypic dissection of bone mineral density reveals skeletal site specificity and facilitates the identification of novel loci in the genetic regulation of bone mass attainment.
24255709 2013 Increased expression of matrix extracellular phosphoglycoprotein (MEPE) in cortical bone of the rat tibia after mechanical loading: identification by oligonucleotide microarray.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23570370 2013 MicroRNA-376a sensitizes cells following DNA damage by downregulating MEPE expression.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22582013 2012 Secreted kinase phosphorylates extracellular proteins that regulate biomineralization.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22341070 2012 The effect of matrix extracellular phosphoglycoprotein and its downstream osteogenesis-related gene expression on the proliferation and differentiation of human dental pulp cells.
21779381 2011 Genetic determinants of cardiovascular events among women with migraine: a genome-wide association study.
21739089 2012 Matrix extracellular phosphoglycoprotein is expressed in causative tumors of oncogenic osteomalacia.
More...