Property Summary

NCBI Gene PubMed Count 10
Grant Count 10
R01 Count 10
Funding $1,299,425.2
PubMed Score 25.94
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.267 0.000
atypical teratoid / rhabdoid tumor 2.300 0.025
medulloblastoma, large-cell 3.300 0.008
group 3 medulloblastoma 2.800 0.012
ovarian cancer -5.500 0.000

Gene RIF (2)

PMID Text
19568415 LHX9 gene is frequently silenced in pediatric malignant astrocytomas
19545367 Lhx9 and Lhx1 serve as a binary switch in controlling the rostral versus caudal longitudinal turning of the caudal commissural axons. Lhx1 determines caudal turning and Lhx9 triggers rostral turning.

AA Sequence

MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL      1 - 70
CAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGI     71 - 140
SASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGG    141 - 210
LALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLR    211 - 280
TMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADS    281 - 350
GALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF                           351 - 397
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
19568415 2009 Aberrant methylation and reduced expression of LHX9 in malignant gliomas of childhood.
19545367 2009 Transcriptional control of axonal guidance and sorting in dorsal interneurons by the Lim-HD proteins Lhx9 and Lhx1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11397841 2001 Absence of mutations involving the LIM homeobox domain gene LHX9 in 46,XY gonadal agenesis and dysgenesis.
9880598 1999 Lhx9: a novel LIM-homeodomain gene expressed in the developing forebrain.
More...