Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.51
PubTator Score 9.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Frasier syndrome 7 3.742 1.9
Narcolepsy 72 3.109 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.4e-02
group 3 medulloblastoma 2.800 1.2e-02
medulloblastoma, large-cell 1.500 2.2e-02
osteosarcoma -1.267 1.6e-06
ovarian cancer -5.500 4.1e-24

Gene RIF (2)

AA Sequence

MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL      1 - 70
CAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCARCHLGI     71 - 140
SASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQLSYTELAAKSGG    141 - 210
LALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNENEADHLDRDQQPYPPSQKTKRMRTSFKHHQLR    211 - 280
TMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADS    281 - 350
GALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF                           351 - 397
//

Text Mined References (12)

PMID Year Title