Property Summary

NCBI Gene PubMed Count 97
Grant Count 35
R01 Count 16
Funding $6,453,505.08
PubMed Score 328.37
PubTator Score 381.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis -1.400 0.000
glioblastoma -3.300 0.002
osteosarcoma 1.254 0.000
posterior fossa group B ependymoma -2.700 0.000
group 3 medulloblastoma -3.000 0.002
cystic fibrosis -5.218 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -2.900 0.010
primitive neuroectodermal tumor -2.800 0.000
tuberculosis and treatment for 3 months 2.300 0.000
colon cancer -1.900 0.008
lung cancer 2.700 0.000
adult high grade glioma -2.200 0.001
pilocytic astrocytoma -1.100 0.006
severe Alzheimer's disease -1.256 0.048
Breast cancer -2.400 0.000
lung carcinoma -1.100 0.000
Pick disease -1.200 0.036
ulcerative colitis 1.300 0.000
ovarian cancer -2.500 0.000

Gene RIF (69)

PMID Text
26620550 Reduction in plasma membrane PI(4,5)P2 abundance by PTPRN2 and PLCbeta1 releases the PI(4,5)P2-binding protein cofilin from its inactive membrane-associated state into the cytoplasm where it mediates actin turnover dynamics.
26434682 Polymorphism of the PLCB4/B1 genes might be involved in the coronary artery aneurysm pathogenesis of Kawasaki disease.
25977289 results show that PI-PLCbeta1 quantification in MDS predicts the response to azacitidine and is associated with an increased myeloid differentiation.
25649181 The rs6108160 polymorphism in the PLCB1 gene reached statistical significance after antidepressant drug use.
25192965 one specific Egr-1 binding site was identified at nt-451/-419 and PLCB1 promoter activity was increased more than 5-fold
25160985 Our data indicate that the amplification of PLCb1a expression, following treatment with kinamycin F, confers a real advantage to K562 cells viability and protects cells themselves from apoptosis.
24684524 PLCB1 is now reported in a number of different EIEE (early infantile epileptic encephalopathy) phenotypes and our report provides further evidence for phenotypic pleiotropy encountered in early infantile epilepsy syndromes.
24475116 Phospholipase C-beta1 and beta4 contribute to non-genetic cell-to-cell variability in histamine-induced calcium signals in HeLa cells.
24338081 The selectivity of PLCbeta toward certain genes lies in the rate at which the RNA is hydrolyzed by C3PO.
24315024 Novel variations in PLCB1 do not allow prediction of functional phenotypes that might explain, at least in part, the symptoms of malignant migrating partial seizures of infancy (MMPSI).
More...

AA Sequence

MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKETELLDLSLVK      1 - 70
DARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATN     71 - 140
LLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSIPQEDFTPE    141 - 210
VYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEP    211 - 280
NNSLARKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYR    281 - 350
QVLLSGCRCVELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ    351 - 420
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQASNTY    421 - 490
SDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKK    491 - 560
RNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMVALNFQTMD    561 - 630
LAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVD    631 - 700
MFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPG    701 - 770
YHYICLRNERNQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK    771 - 840
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTI    841 - 910
EELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKSAKKDSKKKSEP    911 - 980
SSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKLTDVAEECQ    981 - 1050
NNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKR   1051 - 1120
QEKLVEKHKEIRQQILDEKPKLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDP   1121 - 1190
GKVNHKTPSSEELGGDIPGKEFDTPL                                               1191 - 1216
//

Text Mined References (100)

PMID Year Title
26620550 2016 PTPRN2 and PLC?1 promote metastatic breast cancer cell migration through PI(4,5)P2-dependent actin remodeling.
26434682 2015 Genetic variants in PLCB4/PLCB1 as susceptibility loci for coronary artery aneurysm formation in Kawasaki disease in Han Chinese in Taiwan.
25977289 2015 An increased expression of PI-PLC?1 is associated with myeloid differentiation and a longer response to azacitidine in myelodysplastic syndromes.
25649181 2015 Identifying genetic loci associated with antidepressant drug response with drug-gene interaction models in a population-based study.
25416956 2014 A proteome-scale map of the human interactome network.
25192965 2014 Characterization of the PLCB1 promoter and regulation by early growth response transcription factor EGR-1.
25160985 2015 PLC?1a and PLC?1b selective regulation and cyclin D3 modulation reduced by kinamycin F during k562 cell differentiation.
24684524 2014 Severe infantile epileptic encephalopathy due to mutations in PLCB1: expansion of the genotypic and phenotypic disease spectrum.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
24475116 2014 Phospholipase C-?1 and ?4 contribute to non-genetic cell-to-cell variability in histamine-induced calcium signals in HeLa cells.
More...