Property Summary

NCBI Gene PubMed Count 5
Grant Count 4
R01 Count 4
Funding $610,293
PubMed Score 20.10
PubTator Score 13.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Atrial Fibrillation 110 3.057 1.5

Expression

Synonym

Accession Q9NQ60 B2RPB3 B7ZMK1 Q5TCU1 Q96L22
Symbols AFAF
SPACA8
C9orf11

Gene

Gene RIF (2)

PMID Text
20801718 A genome-wide association study finds that the chromosome 9p21 locus is a major cause of familial amyotrophic lateral sclerosis in the Finnish population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNFILFIFIPGVFSLKSSTLKPTIEALPNVLPLNEDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYVF      1 - 70
TTQNPNGTESEISVRATTDLNFALKNDKTVNATTYEKSTIEEETTTSEPSHKNIQRSTPNVPAFWTMLAK     71 - 140
AINGTAVVMDDKDQLFHPIPESDVNATQGENQPDLEDLKIKIMLGISLMTLLLFVVLLAFCSATLYKLRH    141 - 210
LSYKSCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIG    211 - 280
SDNEMHENDESVTR                                                            281 - 294
//

Text Mined References (7)

PMID Year Title
20801718 2010 Chromosome 9p21 in amyotrophic lateral sclerosis in Finland: a genome-wide association study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16831425 2006 Afaf, a novel vesicle membrane protein, is related to acrosome formation in murine testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11118625 2000 Isolation and characterisation of a novel human gene (C9orf11) on chromosome 9p21, a region frequently deleted in human cancer.