Property Summary

NCBI Gene PubMed Count 5
PubMed Score 17.05
PubTator Score 13.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Atrial Fibrillation 124 3.04 1.5

Expression

Gene RIF (2)

AA Sequence

MNFILFIFIPGVFSLKSSTLKPTIEALPNVLPLNEDVNKQEEKNEDHTPNYAPANEKNGNYYKDIKQYVF      1 - 70
TTQNPNGTESEISVRATTDLNFALKNDKTVNATTYEKSTIEEETTTSEPSHKNIQRSTPNVPAFWTMLAK     71 - 140
AINGTAVVMDDKDQLFHPIPESDVNATQGENQPDLEDLKIKIMLGISLMTLLLFVVLLAFCSATLYKLRH    141 - 210
LSYKSCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIG    211 - 280
SDNEMHENDESVTR                                                            281 - 294
//

Text Mined References (7)

PMID Year Title