Property Summary

NCBI Gene PubMed Count 7
PubMed Score 812.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Synonym

Accession Q9NQ55 C9J3F9 Q9BW97 Q9H170 Ssf-1
Symbols

Gene RIF (1)

PMID Text
22174317 HIV-1 Rev interacting protein, PPAN-P2RY11 read through, is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PPAN-P2RY11 is increased by RRE

AA Sequence

MGQSGRSRHQKRARAQAQLRNLEAYAANPHSFVFTRGCTGRNIRQLSLDVRRVMEPLTASRLQVRKKNSL      1 - 70
KDCVAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVKKYSLVRDVVSSLRRHRMHEQQFAHPPL     71 - 140
LVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRCLLIDYNPDSQELDFRHYSIKVVPVGASRGM    141 - 210
KKLLQEKFPNMSRLQDISELLATGAGLSESEAEPDGDHNITELPQAVAGRGNMRAQQSAVRLTEIGPRMT    211 - 280
LQLIKVQEGVGEGKVMFHSFVSKTEEELQAILEAKEKKLRLKAQRQAQQAQNVQRKQEQREAHRKKSLEG    281 - 350
MKKARVGGSDEEASGIPSRTASLELGEDDDEQEDDDIEYFCQAVGEAPSEDLFPEAKQKRLAKSPGRKRK    351 - 420
RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGGRGRGRGRPGKRVA                     421 - 473
//

Text Mined References (11)

PMID Year Title
24204295 2013 Genome wide analysis of narcolepsy in China implicates novel immune loci and reveals changes in association prior to versus after the 2009 H1N1 influenza pandemic.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
12077223 2002 Extracellular adenine nucleotides inhibit the activation of human CD4+ T lymphocytes.
11278528 2001 Cotranscription and intergenic splicing of human P2Y11 and SSF1 genes.
10944437 2000 Cloning, genomic organization, and tissue distribution of human Ssf-1.
More...