Property Summary

NCBI Gene PubMed Count 20
Grant Count 2
Funding $17,912.25
PubMed Score 7.33
PubTator Score 6.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.318 0.017
lung cancer 1.100 0.012
ovarian cancer 2.000 0.000

Synonym

Accession Q9NQ50 B3KVZ7 O95134 L40mt
Symbols URIM
L40mt
NLVCF
MRPL22
MRP-L22
MRP-L40

Gene

 Grant Application (2)

PDB

3J9M   3J7Y  

 GO Function (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKR      1 - 70
KIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAML     71 - 140
EAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKVYTQVEFKR        141 - 206
//

Text Mined References (22)

PMID Year Title
26221035 2015 Mitochondrial Citrate Transporter-dependent Metabolic Signature in the 22q11.2 Deletion Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23172368 2012 Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18775783 2008 Mitochondrial localization and function of a subset of 22q11 deletion syndrome candidate genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...