Property Summary

NCBI Gene PubMed Count 20
PubMed Score 8.33
PubTator Score 6.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.100 1.2e-02
ovarian cancer 2.000 1.5e-07
pancreatic ductal adenocarcinoma liver m... -1.318 1.7e-02

Synonym

Accession Q9NQ50 B3KVZ7 O95134 L40mt
Symbols URIM
L40mt
NLVCF
MRPL22
MRP-L22
MRP-L40

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (1)

AA Sequence

MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKR      1 - 70
KIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAML     71 - 140
EAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKVYTQVEFKR        141 - 206
//

Text Mined References (23)

PMID Year Title