Property Summary

NCBI Gene PubMed Count 20
PubMed Score 7.33
PubTator Score 6.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.51688282986221E-7
lung cancer 4473 0.0122821563567248
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0170487809977119
Disease Target Count Z-score Confidence
Velocardiofacial syndrome 45 4.173 2.1
DiGeorge syndrome 46 3.956 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.318 0.017
lung cancer 1.100 0.012
ovarian cancer 2.000 0.000

Synonym

Accession Q9NQ50 B3KVZ7 O95134 L40mt
Symbols URIM
L40mt
NLVCF
MRPL22
MRP-L22
MRP-L40

Gene

PDB

3J9M   3J7Y  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

 GO Function (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTASVLRSISLALRPTSGLLGTWQTQLRETHQRASLLSFWELIPMRSEPLRKKKKVDPKKDQEAKERLKR      1 - 70
KIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEETERRALLLKKWSLYKQQERKMERDTIRAML     71 - 140
EAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGPHYTPPIPNYQPPEGRYNDITKVYTQVEFKR        141 - 206
//

Text Mined References (22)

PMID Year Title
26221035 2015 Mitochondrial Citrate Transporter-dependent Metabolic Signature in the 22q11.2 Deletion Syndrome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23172368 2012 Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18775783 2008 Mitochondrial localization and function of a subset of 22q11 deletion syndrome candidate genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...