Property Summary

NCBI Gene PubMed Count 19
PubMed Score 9.90
PubTator Score 8.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
BARDET-BIEDL SYNDROME 17 1 0.0 0.0
Disease Target Count Z-score Confidence
Polydactyly 107 3.378 1.7
Situs Inversus 65 3.187 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 5.9e-03
chronic rhinosinusitis -1.622 4.3e-02
ependymoma -1.100 2.2e-02
glioblastoma -1.500 3.9e-03
medulloblastoma -1.200 9.3e-04
medulloblastoma, large-cell -1.100 6.8e-03
nasopharyngeal carcinoma -1.100 4.8e-03
non-small cell lung cancer -1.196 1.2e-14
oligodendroglioma -1.400 5.3e-03
osteosarcoma 1.636 4.3e-06
ovarian cancer -1.900 4.3e-05
Pick disease -1.300 1.0e-02
psoriasis -1.200 3.4e-07
tuberculosis and treatment for 3 months -1.300 6.8e-05

Protein-protein Interaction (8)

Gene RIF (8)

AA Sequence

MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVE      1 - 70
SELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAP     71 - 140
LNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSN    141 - 210
LENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTK    211 - 280
KNDQIKDLRKRLAQYEPED                                                       281 - 299
//

Text Mined References (22)

PMID Year Title