Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.37
PubTator Score 8.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.100 0.006
posterior fossa group B ependymoma 2.000 0.000
oligodendroglioma -1.400 0.005
psoriasis -1.200 0.000
osteosarcoma 1.636 0.000
glioblastoma -1.500 0.004
medulloblastoma -1.200 0.001
medulloblastoma, large-cell -1.100 0.007
tuberculosis and treatment for 3 months -1.300 0.000
non-small cell lung cancer -1.196 0.000
nasopharyngeal carcinoma -1.100 0.005
Pick disease -1.300 0.010
ovarian cancer -1.900 0.000
chronic rhinosinusitis -1.622 0.043

Gene RIF (7)

PMID Text
26700766 these data indicate that LZTFL1 modulates T cell activation and IL-5 levels.
25005785 LZTFL1 binds beta-catenin in the cytoplasm of the cell and inhibited its nuclear translocation
23692385 This special subtype of polydactyly in BBS patients is easily identified on clinical examination and prompts for priority sequencing of LZTFL1 (BBS17).
22510444 The absence of LZTFL1 leads to a BBS phenotype with enhanced developmental abnormalities associated with cellular Shh dysfunction. LZTFL1 is a novel BBS gene (BBS17).
22072986 Our findings suggest that LZTFL1 is an important regulator of BBSome ciliary trafficking and hedgehog signaling
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233871 LZTFL1 may inhibit tumorigenesis by stabilizing E-cadherin-mediated adherens junction formation and promoting epithelial cell differentiation.

AA Sequence

MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNGLQAVVHSEVE      1 - 70
SELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAP     71 - 140
LNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFIKAQDLSN    141 - 210
LENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTK    211 - 280
KNDQIKDLRKRLAQYEPED                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26700766 2016 LZTFL1 Upregulated by All-Trans Retinoic Acid during CD4+ T Cell Activation Enhances IL-5 Production.
25416956 2014 A proteome-scale map of the human interactome network.
25005785 2014 LZTFL1 suppresses gastric cancer cell migration and invasion through regulating nuclear translocation of ?-catenin.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24550735 2014 The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome.
23692385 2014 Mesoaxial polydactyly is a major feature in Bardet-Biedl syndrome patients with LZTFL1 (BBS17) mutations.
22510444 2012 Exome sequencing identifies mutations in LZTFL1, a BBSome and smoothened trafficking regulator, in a family with Bardet--Biedl syndrome with situs inversus and insertional polydactyly.
22072986 2011 A novel protein LZTFL1 regulates ciliary trafficking of the BBSome and Smoothened.
More...