Property Summary

NCBI Gene PubMed Count 32
Grant Count 6
R01 Count 5
Funding $378,828
PubMed Score 64.22
PubTator Score 57.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.140 0.000
intraductal papillary-mucinous neoplasm ... 1.800 0.001
ductal carcinoma in situ 1.200 0.000
psoriasis 1.700 0.000

Synonym

Accession Q9NQ40 A8K6P1 Q5W1A0 Q5W1A1 Q8NCL7 Q96GD5
Symbols RFT2
BVVLS
RFVT3
hRFT2
BVVLS1
C20orf54
bA371L19.1

Gene

PANTHER Protein Class (2)

Gene RIF (24)

PMID Text
26722538 RFT2 plays an important role in gastric carcinogenesis by modulating riboflavin absorption
26154995 C20orf54 rs13042395 polymorphism was significantly associated with decreased ESCC and GCA risk especially for the subjects with under-weight or normal.
25427582 A close association exists between functional SNP rs3746804 in C20orf54 and susceptibility to esophageal squamous cell carcinoma
25394472 Binding of Sp1 to the minimal SLC52A3 promoter.
25045844 Results suggest that RFT2 contributes to esophageal squamous cell carcinoma tumorigenesis and may serve as a potential therapeutic target.
24761851 Increase in methylation of CpG 2 and CpG 3 in hRFT2gene promoter region is associated with the genesis of cervical squamous cell carcinoma.
24264046 These results strongly suggest that RFVT3 would functionally be involved in riboflavin absorption in the apical membranes of intestinal epithelial cells
24260322 C20orf54 expression were significantly up-regulated in CSCC.
24152165 the single-nucleotide polymorphism rs13042395 in C20orf54 showed a significantly lower risk of esophageal squamous cell carcinoma in the younger age group but no significant association in the older group in a Korean population.
24139842 data suggest that MMND is a distinct clinical subgroup of childhood onset MND patients where the known genetic defects are so far negative.
More...

AA Sequence

MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLS      1 - 70
EVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTT     71 - 140
FFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLE    141 - 210
SRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVD    211 - 280
SSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASL    281 - 350
VSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV    351 - 420
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA                         421 - 469
//

Text Mined References (32)

PMID Year Title
26722538 2015 Correlation analysis of riboflavin, RFT2 and Helicobater pylori in gastric carcinoma.
26154995 2015 Esophageal Squamous Cell Carcinoma and Gastric Cardia Adenocarcinoma Shared Susceptibility Locus in C20orf54: Evidence from Published Studies.
25427582 2014 The functional SNP rs3746804 in C20orf54 modifies susceptibility to esophageal squamous cell carcinoma.
25394472 2015 Identification and characterization of the minimal 5'-regulatory region of the human riboflavin transporter-3 (SLC52A3) in intestinal epithelial cells.
25045844 2014 RFT2 is overexpressed in esophageal squamous cell carcinoma and promotes tumorigenesis by sustaining cell proliferation and protecting against cell death.
24761851 2014 Epigenetic regulation of human riboflavin transporter 2(hRFT2) in cervical cancers from Uighur women.
24264046 2014 Functional involvement of RFVT3/SLC52A3 in intestinal riboflavin absorption.
24260322 2013 Association of the plasma and tissue riboflavin levels with C20orf54 expression in cervical lesions and its relationship to HPV16 infection.
24152165 Replication of results of genome-wide association studies on esophageal squamous cell carcinoma susceptibility loci in a Korean population.
24139842 2013 Madras motor neuron disease (MMND) is distinct from the riboflavin transporter genetic defects that cause Brown-Vialetto-Van Laere syndrome.
More...