Property Summary

NCBI Gene PubMed Count 38
PubMed Score 71.31
PubTator Score 57.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ 1.200 1.7e-04
intraductal papillary-mucinous neoplasm ... 1.800 8.3e-04
osteosarcoma 1.140 3.9e-06
psoriasis 1.700 4.8e-62

Gene RIF (30)

AA Sequence

MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTLLHHFRPSCLS      1 - 70
EVPIIFTLLGVGTVTCIIFAFLWNMTSWVLDGHHSIAFLVLTFFLALVDCTSSVTFLPFMSRLPTYYLTT     71 - 140
FFVGEGLSGLLPALVALAQGSGLTTCVNVTEISDSVPSPVPTRETDIAQGVPRALVSALPGMEAPLSHLE    141 - 210
SRYLPAHFSPLVFFLLLSIMMACCLVAFFVLQRQPRCWEASVEDLLNDQVTLHSIRPREENDLGPAGTVD    211 - 280
SSQGQGYLEEKAAPCCPAHLAFIYTLVAFVNALTNGMLPSVQTYSCLSYGPVAYHLAATLSIVANPLASL    281 - 350
VSMFLPNRSLLFLGVLSVLGTCFGGYNMAMAVMSPCPLLQGHWGGEVLIVASWVLFSGCLSYVKVMLGVV    351 - 420
LRDLSRSALLWCGAAVQLGSLLGALLMFPLVNVLRLFSSADFCNLHCPA                         421 - 469
//

Text Mined References (42)

PMID Year Title