Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NQ39
Symbols RPS10L
bA371L19.2
RPS10_13_1677

Gene

 Compartment GO Term (0)

AA Sequence

MLMPKKNRIAIHELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQFAWRHFYWY      1 - 70
LTNEGSQYLRDYLHLPPEIVPATLHLPPEIVPATLHRSRPETGRPRPKGLEGKRPARLTRREADRDTYRR     71 - 140
CSVPPGADKKAEAGAGSATEFQFRGRCGRGRGQPPQ                                      141 - 176
//

Text Mined References (2)

PMID Year Title