Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NQ39
Symbols RPS10L
bA371L19.2
RPS10_13_1677

Gene

 Compartment GO Term (0)

AA Sequence

MLMPKKNRIAIHELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQFAWRHFYWY      1 - 70
LTNEGSQYLRDYLHLPPEIVPATLHLPPEIVPATLHRSRPETGRPRPKGLEGKRPARLTRREADRDTYRR     71 - 140
CSVPPGADKKAEAGAGSATEFQFRGRCGRGRGQPPQ                                      141 - 176
//

Text Mined References (2)

PMID Year Title
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.