Property Summary

NCBI Gene PubMed Count 23
PubMed Score 11.44
PubTator Score 12.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active ulcerative colitis -2.548 2.4e-02
Astrocytoma, Pilocytic 2.000 2.3e-06
atypical teratoid / rhabdoid tumor 1.500 5.9e-03
colon cancer -2.700 4.0e-04
ependymoma 1.800 3.2e-03
glioblastoma 1.100 1.3e-02
interstitial cystitis -3.200 1.6e-03
intraductal papillary-mucinous adenoma (... -1.900 2.2e-04
intraductal papillary-mucinous carcinoma... -1.800 4.6e-04
intraductal papillary-mucinous neoplasm ... -1.400 2.2e-02
lung cancer -1.500 3.7e-02
nasopharyngeal carcinoma -1.700 6.0e-08
oligodendroglioma 1.300 8.0e-03
pediatric high grade glioma 1.200 2.0e-02
pituitary cancer -1.100 2.0e-04
primary Sjogren syndrome 1.400 1.3e-03
urothelial carcinoma -2.600 2.8e-02

Gene RIF (17)

AA Sequence

MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYK      1 - 70
CSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQ     71 - 140
HTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQ    141 - 210
RDCILTCNHGNGGCQHSCDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRR    211 - 280
LLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCK    281 - 350
KGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN    351 - 420
TVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHLSSDVTTIRTS    421 - 490
VTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFE    491 - 560
LETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAKKPPRTSERQAESCGVG    561 - 630
QGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQP    631 - 700
GEYSADGFAPCHLCALGTFQPEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRC    701 - 770
PVGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTIN    771 - 840
PPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNS    841 - 910
ARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFP    911 - 980
RSFIRLLRSKVSRFLRPYK                                                       981 - 999
//

Text Mined References (27)

PMID Year Title