Property Summary

NCBI Gene PubMed Count 20
Grant Count 6
R01 Count 6
Funding $173,594.47
PubMed Score 10.86
PubTator Score 12.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
25672935 SCUBE2 expression was decreased at the transcriptional and translational levels in colorectal cancer tissues and significantly associated with clinical stage, the depth of tumor invasion, lymphnode metastasis, distant metastasis and histological grade.
24522195 Sheddases and Scube2 act cooperatively to increase the pool of soluble bioactive Shh.
24213532 Tumor suppressor SCUBE2 inhibits breast-cancer cell migration and invasion through the reversal of epithelial-mesenchymal transition.
24084593 Via obligate assistance of Scube1 and 3, Scube2 plays a center role to recruit dually lipid-modified Hedgehog transferred from Dispatched A (DispA), increasing Hh secretion by promoting its solubility.
24053619 data suggest that signal peptide CUB domain (SCUBE2), like in breast cancer, associates with estrogen receptor alpha and might have a potential as prognostic or predictive marker in endometrial cancer
21652720 Domain and functional analysis of a novel breast tumor suppressor protein, SCUBE2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19480626 The full-length cDNA of human SCUBE2 was isolated and the role in the hedgehog signalling cascade, was studied.
More...

AA Sequence

MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQNTPTSYK      1 - 70
CSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDGHNCLDVDECLENNGGCQ     71 - 140
HTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQ    141 - 210
RDCILTCNHGNGGCQHSCDDTADGPECSCHPQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRR    211 - 280
LLMETCAVNNGGCDRTCKDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCK    281 - 350
KGFKLLTDEKSCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN    351 - 420
TVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHLSSDVTTIRTS    421 - 490
VTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFE    491 - 560
LETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAKKPPRTSERQAESCGVG    561 - 630
QGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQP    631 - 700
GEYSADGFAPCHLCALGTFQPEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRC    701 - 770
PVGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTIN    771 - 840
PPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNS    841 - 910
ARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFP    911 - 980
RSFIRLLRSKVSRFLRPYK                                                       981 - 999
//

Text Mined References (21)

PMID Year Title
25672935 2015 Decreased expression of SCUBE2 is associated with progression and prognosis in colorectal cancer.
24522195 2014 Scube2 enhances proteolytic Shh processing from the surface of Shh-producing cells.
24213532 2014 Tumor suppressor SCUBE2 inhibits breast-cancer cell migration and invasion through the reversal of epithelial-mesenchymal transition.
24084593 2013 Scube regulates synovial angiogenesis-related signaling.
24053619 2013 Expression of SCUBE2 gene declines in high grade endometrial cancer and associates with expression of steroid hormone receptors and tumor suppressor PTEN.
23279374 2013 Genetic determinants of plasma ??-glycoprotein I levels: a genome-wide association study in extended pedigrees from Spain.
21652720 2011 Domain and functional analysis of a novel breast tumor suppressor protein, SCUBE2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
More...