Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.96
PubTator Score 1.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 3.3e-04
intraductal papillary-mucinous neoplasm ... 1.300 2.0e-02
lung adenocarcinoma -1.600 1.2e-16
medulloblastoma, large-cell -1.500 1.6e-04
Multiple myeloma 1.257 6.6e-04
osteosarcoma -1.213 5.8e-05
ovarian cancer -1.800 1.2e-09
posterior fossa group B ependymoma 1.200 3.6e-05
sonic hedgehog group medulloblastoma -1.100 7.6e-05

 GO Function (1)

Gene RIF (1)

AA Sequence

MATLWGGLLRLGSLLSLSCLALSVLLLAQLSDAAKNFEDVRCKCICPPYKENSGHIYNKNISQKDCDCLH      1 - 70
VVEPMPVRGPDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLI     71 - 140
QSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS                141 - 198
//

Text Mined References (14)

PMID Year Title