Property Summary

NCBI Gene PubMed Count 5
Grant Count 11
R01 Count 6
Funding $2,392,092.68
PubMed Score 21.73
PubTator Score 16.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 1.400 0.000
medulloblastoma, large-cell 1.400 0.000
adult high grade glioma 1.100 0.002
ovarian cancer 1.200 0.000

AA Sequence

MDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEP      1 - 70
CPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKY     71 - 140
INYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV                                  141 - 180
//

Text Mined References (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15475265 2004 Hash4, a novel human achaete-scute homologue found in fetal skin.
11784080 2001 Sgn1, a basic helix-loop-helix transcription factor delineates the salivary gland duct cell lineage in mice.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.