Property Summary

NCBI Gene PubMed Count 5
PubMed Score 21.73
PubTator Score 16.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.40616127340587E-8
osteosarcoma 7933 4.9966109590441E-6
medulloblastoma, large-cell 6234 7.93025099056754E-6
psoriasis 6685 7.19351467605485E-4
adult high grade glioma 2148 0.00212968813495019
Disease Target Count Z-score Confidence
Ascariasis 7 3.841 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.300 0.001
osteosarcoma 1.400 0.000
medulloblastoma, large-cell 1.400 0.000
adult high grade glioma 1.100 0.002
ovarian cancer 1.200 0.000

Synonym

Accession Q9NQ33 Q8WYQ6 ASH-3
Symbols SGN1
HASH3
bHLHa42

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MDNRGNSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEP      1 - 70
CPFSFPMPYPNYRGCEYSYGPAFTRKRNERERQRVKCVNEGYAQLRHHLPEEYLEKRLSKVETLRAAIKY     71 - 140
INYLQSLLYPDKAETKNNPGKVSSMIATTSHHADPMFRIV                                  141 - 180
//

Text Mined References (5)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15475265 2004 Hash4, a novel human achaete-scute homologue found in fetal skin.
11784080 2001 Sgn1, a basic helix-loop-helix transcription factor delineates the salivary gland duct cell lineage in mice.
11528127 2001 Comparative genomic sequencing reveals a strikingly similar architecture of a conserved syntenic region on human chromosome 11p15.3 (including gene ST5) and mouse chromosome 7.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.