1. Home
  2. Targets
  3. A-kinase-interacting protein 1

Tbio A-kinase-interacting protein 1

Enhances NF-kappa-B transcriptional activity by regulating the nuclear localization of the NF-kappa-B subunit RELA and promoting the phosphorylation of RELA by PRKACA. Regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade.

This gene encodes a nuclear protein that interacts with protein kinase A catalytic subunit, and regulates the effect of the cAMP-dependent protein kinase signaling pathway on the NF-kappa-B activation cascade. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Oct 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 17
PubMed Score 17.64
PubTator Score 12.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 4.68319893503613E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00371865473933646
colon cancer 1475 0.0136291271536376
subependymal giant cell astrocytoma 2287 0.0439452106393112
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.115 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.004
colon cancer 1.200 0.014
subependymal giant cell astrocytoma 1.040 0.044

Synonym

Accession Q9NQ31 Q8NBS2 Q8TAC6 Q8TAD3 Q8TAE0
Symbols BCA3
C11orf17

Gene

AKIP1

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG

 GO Component (1)

 GO Process (2)

 Compartment GO Term (18)

See all...

 MGI Term (1)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

 UniProt Keyword (6)

Gene RIF (11)

PMID Text
25526186 The absence of exon 3 and exon 5 influenced the subcellular localization of BCA3 and nuclear factor kappa B (NF-kB)-dependent gene expression.
24886575 HIV-1 PR(D25N) directly interacts with BCA3 in cells and co-localizes with BCA3 in the cytoplasm, particularly at the mitochondria
24659101 Expression of BCA3 did not affect Mason-Pfizer money virus (MPMV) particle release and proteolytic processing; however, it slightly increased MPMV infectivity.
24413079 Data indicate an important role for A-kinase-interacting protein 1 (AKIP1) in esophageal squamous cell carcinoma (ESCC) angiogenesis and lymphangiogenesis.
23319652 Data indicate A-kinase interacting protein 1 (AKIP1) as a critical molecular regulator and a therapeutic control point for stress adaptation in the heart.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20562110 action of PKA signaling on the NF-kappaB activation cascade
19913121 Observational study of gene-disease association. (HuGE Navigator)
18178962 AKIP1 colocalized with p65 within the cells and appeared to retain p65 in nucleus.
15630084 AKIP1 describes a PKA-interacting protein that can contribute to localization by a mechanism that is distinct from A-kinase anchoring proteins that interact with the regulatory subunits.
More...

AA Sequence 

MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV      1 - 70
LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR     71 - 140
KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV    141 - 210
//

Text Mined References (17)

PMID Year Title
25526186 2014 Cloning and functional identification of a novel BCA3 splice.
24659101 2014 Breast cancer-associated protein--a novel binding partner of Mason-Pfizer monkey virus protease.
24413079 2015 Overexpression of AKIP1 promotes angiogenesis and lymphangiogenesis in human esophageal squamous cell carcinoma.
23319652 2013 A kinase interacting protein (AKIP1) is a key regulator of cardiac stress.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562110 2010 A-kinase-interacting protein 1 (AKIP1) acts as a molecular determinant of PKA in NF-kappaB signaling.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18178962 2008 AKIP1 enhances NF-kappaB-dependent gene expression by promoting the nuclear retention and phosphorylation of p65.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15630084 2005 A-kinase-interacting protein localizes protein kinase A in the nucleus.
More...