Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.94
PubTator Score 12.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.200 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.200 3.7e-03
osteosarcoma -1.115 4.7e-04
subependymal giant cell astrocytoma 1.040 4.4e-02

Synonym

Accession Q9NQ31 Q8NBS2 Q8TAC6 Q8TAD3 Q8TAE0
Symbols BCA3
C11orf17

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MDNCLAAAALNGVDRRSLQRSARLALEVLERAKRRAVDWHALERPKGCMGVLAREAPHLEKQPAAGPQRV      1 - 70
LPGEREERPPTLSASFRTMAEFMDYTSSQCGKYYSSVPEEGGATHVYRYHRGESKLHMCLDIGNGQRKDR     71 - 140
KKTSLGPGGSYQISEHAPEASQPAENISKDLYIEVYPGTYSVTVGSNDLTKKTHVVAVDSGQSVDLVFPV    141 - 210
//

Text Mined References (17)

PMID Year Title