Property Summary

NCBI Gene PubMed Count 58
PubMed Score 153.39
PubTator Score 111.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis 1.439 0.003
interstitial lung disease -1.200 0.046
urothelial carcinoma 1.700 0.028
glioblastoma multiforme 1.300 0.000
posterior fossa group A ependymoma 1.600 0.000
cystic fibrosis 5.524 0.000
adrenocortical carcinoma 1.502 0.002
colon cancer 1.700 0.000
pediatric high grade glioma 1.200 0.002
group 3 medulloblastoma 1.700 0.002
pilocytic astrocytoma 1.600 0.001
invasive ductal carcinoma 1.200 0.010
ovarian cancer 1.500 0.010

Gene RIF (51)

PMID Text
27010153 The levels of ESM1, CLDN5, IL-1beta, IL-6, and TNF-alpha were significantly higher in the migraine attack group than in the control group
26924874 Results found that serum endocan levels were significantly lower in Alzheimer's disease (AD) patients with depression than in AD patients without depression or healthy controls suggesting that serum endocan levels might be associated with depression in AD.
26823798 Endocan may play a role in the progression of pregnancy and has a potential to be a new marker for the detection of pre-eclampsia
26808694 serum levels of endocan, a new biomarker of endothelial dysfunction, increase in obstructive sleep apnea subjects.
26418319 Serum endocan concentrations were significantly elevated in women with pre-eclampsia versus normotensive controls, and concentrations seem to be associated with the severity of the disease.
26200037 Serum endocan level is independently correlated with the presence and severity of coronary artery disease in hypertension patients.
26147320 Serum ESM1 was significantly lower in type 2 diabetes patients than in controls.
26125749 Detection of ESM-1 levels in the serum may serve as a tumor biomarker for assessing prognosis in colorectal cancer.
25969567 Suggest that serum endocan concentrations are elevated in patients with type 2 diabetes and decrease following anti-hyperglycemic treatment.
25957465 higher levels of Endocan-1 were found in maternal plasma in pre-eclamptic group; placental Endocan-1 levels were lower in pre-eclampsia and fetal levels did not show any difference between groups; upregulation of maternal plasma Endocan-1 in the pre-eclamptic group was observed when when stratified in relation to gestational age, systolic blood pressure and proteinuria
More...

AA Sequence

MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVS      1 - 70
GMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVT     71 - 140
KSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR                              141 - 184
//

Text Mined References (61)

PMID Year Title
27010153 2016 Serum levels of endocan, claudin-5 and cytokines in migraine.
26924874 2016 The Relationship between Serum Endocan Levels and Depression in Alzheimer's Disease.
26823798 2015 Endocan of the maternal placenta tissue is increased in pre-eclampsia.
26808694 2016 Serum endothelial cell specific molecule-1 (endocan) levels in patients with obstructive sleep apnea.
26418319 2016 Serum levels of endocan correlate with the presence and severity of pre-eclampsia.
26200037 2015 Elevated Human Endothelial Cell-Specific Molecule-1 Level and Its Association With Coronary Artery Disease in Patients With Hypertension.
26147320 2015 Endocan: a new biomarker associated with inflammation in type 2 diabetes mellitus?
26125749 2015 Serum level of endothelial cell-specific molecule-1 and prognosis of colorectal cancer.
25969567 2016 Effect of Glycemic Regulation on Endocan Levels in Patients With Diabetes: A Preliminary Study.
25957465 2015 Endocan-1 concentrations in maternal and fetal plasma and placentae in pre-eclampsia in the third trimester of pregnancy.
More...