Property Summary

Ligand Count 1
NCBI Gene PubMed Count 37
PubMed Score 55.93
PubTator Score 469.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Breast cancer -3.000 2.7e-02
Chronic obstructive pulmonary disease -1.100 1.6e-02
chronic rhinosinusitis 1.047 4.5e-02
cutaneous lupus erythematosus 3.300 4.7e-04
group 3 medulloblastoma -1.200 2.7e-02
interstitial cystitis 2.500 1.3e-02
invasive ductal carcinoma 1.151 2.2e-02
lung adenocarcinoma 1.300 2.1e-07
lung cancer -2.200 1.2e-02
lung carcinoma -1.500 3.8e-09
mucosa-associated lymphoid tissue lympho... 2.068 3.2e-02
non-small cell lung carcinoma 1.200 1.3e-10
osteosarcoma -1.804 4.4e-03
periodontitis 1.800 1.2e-22
primary Sjogren syndrome 2.100 3.4e-03
psoriasis 1.100 2.4e-13
sarcoidosis 1.700 4.4e-02
tuberculosis and treatment for 6 months -1.700 1.0e-02
ulcerative colitis 2.100 3.6e-04

Gene RIF (19)

AA Sequence

MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI      1 - 70
IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN     71 - 140
KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL    141 - 210
ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE    211 - 280
NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI                   281 - 335
//

Text Mined References (40)

PMID Year Title