Property Summary

NCBI Gene PubMed Count 32
Grant Count 4
R01 Count 3
Funding $411,345.39
PubMed Score 47.55
PubTator Score 469.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (16)

PMID Text
26310579 Blimp-1 regulates the transcription of CS1 gene in NK and B cell lines from multiple myeloma and diffuse large B cell lymphoma patients.
25312647 SLAMF7-triggered inhibition is mediated by a mechanism involving Src kinases, CD45, and SHIP-1 that is defective in MM cells
24299175 Our data highlight the therapeutic potential of targeting CD319 in rheumatoid arthritis
23956418 These results suggest a role for CD319 and CD229 in the systemic lupus erythematosus disease process.
23695528 SLAMF7 plays an inhibitory role in human monocytes to control proinflammatory immune responses.
23250953 These data suggest an involvement of CRACC-mediated NK cell activation in periodontal tissue destruction and point to a plausible distinction in the pathobiology of aggressive and chronic periodontitis.
20345977 altered expression of splice variants of CS1 and 2B4 that mediate differential signalling in PBMC from patients with SLE.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19904767 Data show that pair-wise ligations of 2B4 with DNAM-1 and/or NKG2D lead to increased effector functions of primary CD4(+)CD28(-) T cells to suboptimal levels of anti-CD3 stimulation.
18451245 HuLuc63 eliminates myeloma cells, at least in part, via NK-mediated ADCC and shows the therapeutic potential of targeting CS1 with HuLuc63 for the treatment of multiple myeloma.
More...

AA Sequence

MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI      1 - 70
IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN     71 - 140
KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL    141 - 210
ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE    211 - 280
NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI                   281 - 335
//

Text Mined References (35)

PMID Year Title
26310579 2016 Blimp-1/PRDM1 regulates the transcription of human CS1 (SLAMF7) gene in NK and B cells.
25312647 2015 Immune cell inhibition by SLAMF7 is mediated by a mechanism requiring src kinases, CD45, and SHIP-1 that is defective in multiple myeloma cells.
24299175 2013 PDL241, a novel humanized monoclonal antibody, reveals CD319 as a therapeutic target for rheumatoid arthritis.
23956418 2013 Systemic lupus erythematosus immune complexes increase the expression of SLAM family members CD319 (CRACC) and CD229 (LY-9) on plasmacytoid dendritic cells and CD319 on CD56(dim) NK cells.
23695528 2013 CS1 (SLAMF7) inhibits production of proinflammatory cytokines by activated monocytes.
23250953 2013 Role of the NK cell-activating receptor CRACC in periodontitis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20345977 2010 Altered expression of signalling lymphocyte activation molecule (SLAM) family receptors CS1 (CD319) and 2B4 (CD244) in patients with systemic lupus erythematosus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19904767 2010 Activating NK-cell receptors co-stimulate CD4(+)CD28(-) T cells in patients with rheumatoid arthritis.
More...