Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NQ03
Symbols ZNF898B

Gene

 GO Component (1)

Gene RIF (1)

PMID Text
23434913 Scratch2 and scratch1 are expressed upon neuronal fate commitment under the control of proneural genes to promote cell migration in the developing neocortex.

AA Sequence

MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHRLPPSSYDADQKPGLELAPAE      1 - 70
PAYPPAAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRRRRGGGGGDAGGSGDAGGAGG     71 - 140
RAGRAGAQAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNL    141 - 210
RHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALK    211 - 280
SYLHKHCEAACAKAAEPPPPTPAGPAS                                               281 - 307
//

Text Mined References (4)

PMID Year Title
23434913 2013 Scratch regulates neuronal migration onset via an epithelial-mesenchymal transition-like mechanism.
21252910 2011 Repression of Puma by scratch2 is required for neuronal survival during embryonic development.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11274425 2001 Mammalian Scratch: a neural-specific Snail family transcriptional repressor.