Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.09
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

Gene RIF (1)

AA Sequence

MPRSFLVKKIKGDGFQCSGVPAPTYHPLETAYVLPGARGPPGDNGYAPHRLPPSSYDADQKPGLELAPAE      1 - 70
PAYPPAAPEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAFFISDGRSRRRRGGGGGDAGGSGDAGGAGG     71 - 140
RAGRAGAQAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNL    141 - 210
RHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALK    211 - 280
SYLHKHCEAACAKAAEPPPPTPAGPAS                                               281 - 307
//

Text Mined References (4)

PMID Year Title