Property Summary

NCBI Gene PubMed Count 16
PubMed Score 103.96
PubTator Score 23.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.500 1.4e-02
gastric carcinoma -1.300 3.0e-02
glioblastoma -2.200 1.5e-02
group 3 medulloblastoma -2.100 1.4e-04
ovarian cancer -2.500 3.7e-07
pediatric high grade glioma -2.300 9.5e-04
subependymal giant cell astrocytoma -1.619 3.0e-02

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MKSALFTRFFILLPWILIVIIMLDVDTRRPVPPLTPRPYFSPYAVGRGGARLPLRRGGPAHGTQKRNQSR      1 - 70
PQPQPEPQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAAARSELVSRFLARAGLPSTHL     71 - 140
HVPTPRRYKRPGLPRATEQRNAGLAWLRQRHQHQRAQPGVLFFADDDNTYSLELFQEMRTTRKVSVWPVG    141 - 210
LVGGRRYERPLVENGKVVGWYTGWRADRPFAIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQI    211 - 280
TTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVKIEV                               281 - 323
//

Text Mined References (16)

PMID Year Title