Property Summary

NCBI Gene PubMed Count 59
Grant Count 12
R01 Count 6
Funding $2,127,636
PubMed Score 52.22
PubTator Score 70.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26387756 CD93 expression identifies a predominantly cycling, non-quiescent leukemia-initiating cell population in MLL-rearranged AML, providing opportunities for selective targeting and eradication of LSCs.
26363010 CD93 is a key regulator of glioma angiogenesis and vascular function, acting via cytoskeletal rearrangements required for cell-cell and cell-matrix adhesion.
26008729 The T/T genotype of SNP rs2749817 of CD93 is associated with disseminated cancer.
25288439 These data support a mechanism whereby gC1qR plays an important role in HPV-16 E2-induced human cervical squamous carcinoma cell apoptosis via a mitochondria-dependent pathway.
24807719 Antibody-dependent enhancement of parvovirus B19 involves an alternative mechanism mediated by the heat-sensitive complement factor C1q and its receptor, CD93.
24033555 Expression of CD93 on the lymphocyte population of peripheral blood cells from infants at 1 month after birth was also significantly decreased, compared with that for neonatal umbilical cord blood.
23651874 HPV 16 E2 induces apoptosis by silencing the gC1qR gene or inhibiting p38 MAPK/JNK signalling in cervical squamous cell carcinoma
23272129 soluble EGF-like domain containing CD93 protein is a novel angiogenic factor acting on the endothelium
23268996 These data support a mechanism whereby gC1qR induces apoptosis through the mitochondrial and p53-dependent pathways in cervical squamous cell carcinoma.
23052251 The data indicate that gC1qR inhibits viability, migration and proliferation of cervical squamous cells carcinoma via the p38 MAPK signalling pathway.
More...

AA Sequence

MATSMGLLLLLLLLLTQPGAGTGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQ      1 - 70
HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKR     71 - 140
CVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSS    141 - 210
SLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGD    211 - 280
GSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQ    281 - 350
DSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGE    351 - 420
DGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKE    421 - 490
GSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQE    491 - 560
PAGGDSSVATQNNDGTDGQKLLLFYILGTVVAILLLLALALGLLVYRKRRAKREEKKEKKPQNAADSYSW    561 - 630
VPERAESRAMENQYSPTPGTDC                                                    631 - 652
//

Text Mined References (62)

PMID Year Title
26387756 2015 CD93 Marks a Non-Quiescent Human Leukemia Stem Cell Population and Is Required for Development of MLL-Rearranged Acute Myeloid Leukemia.
26363010 2015 Elevated expression of the C-type lectin CD93 in the glioblastoma vasculature regulates cytoskeletal rearrangements that enhance vessel function and reduce host survival.
26008729 2015 CD93 gene polymorphism is associated with disseminated colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25288439 2014 The role of the globular heads of the C1q receptor in HPV-16 E2-induced human cervical squamous carcinoma cell apoptosis via a mitochondria-dependent pathway.
24807719 2014 Antibody-mediated enhancement of parvovirus B19 uptake into endothelial cells mediated by a receptor for complement factor C1q.
24124411 2013 Genome-wide association study of liver enzymes in korean children.
24033555 2013 Unique properties of cluster of differentiation 93 in the umbilical cord blood of neonates.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23651874 2013 The role of globular heads of the C1q receptor in HPV 16 E2-induced human cervical squamous carcinoma cell apoptosis is associated with p38 MAPK/JNK activation.
More...