Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical adenoma -1.037 3.3e-02
adrenocortical carcinoma -1.448 6.0e-04
adult high grade glioma -2.300 1.3e-06
Astrocytoma, Pilocytic -1.500 3.1e-07
Atopic dermatitis -1.300 8.8e-04
atypical teratoid / rhabdoid tumor -2.900 8.1e-06
autosomal dominant Emery-Dreifuss muscul... 1.013 1.5e-03
colon cancer -1.500 4.8e-02
cutaneous lupus erythematosus -1.700 5.2e-03
cystic fibrosis 3.060 2.7e-07
ependymoma -1.600 3.2e-06
glioblastoma -1.700 6.2e-08
group 3 medulloblastoma -1.300 3.6e-03
intraductal papillary-mucinous adenoma (... -1.900 6.1e-05
intraductal papillary-mucinous carcinoma... -1.900 9.5e-05
intraductal papillary-mucinous neoplasm ... -1.900 1.2e-03
invasive ductal carcinoma -1.400 3.8e-02
lung adenocarcinoma -1.300 9.4e-20
lung cancer -3.000 5.6e-06
malignant mesothelioma -3.000 1.0e-08
medulloblastoma, large-cell -2.200 2.2e-06
non-small cell lung cancer -2.125 1.1e-18
osteosarcoma 1.986 3.6e-03
ovarian cancer -1.200 6.7e-05
primitive neuroectodermal tumor -1.200 2.5e-03
psoriasis -1.700 1.1e-09
subependymal giant cell astrocytoma -2.016 2.4e-02

AA Sequence

MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAANGQGQPEDPPRSSNDAVLLWIAIIATLG      1 - 70
NIVVVGVVYAFTF                                                              71 - 83
//

Text Mined References (9)

PMID Year Title