Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.10810555918837E-18
lung adenocarcinoma 2714 5.7064757075461E-18
psoriasis 6685 1.14866789759003E-9
posterior fossa group A ependymoma 1511 3.32372018026418E-9
malignant mesothelioma 3163 1.02244527782294E-8
pilocytic astrocytoma 3086 8.66985591907589E-8
cystic fibrosis 1670 2.70798773514065E-7
lung cancer 4473 5.19999986951239E-7
adult high grade glioma 2148 7.15694872952092E-7
medulloblastoma, large-cell 6234 2.15662453726573E-6
atypical teratoid / rhabdoid tumor 4369 8.05216916548876E-6
glioblastoma 5572 5.47511612801321E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 6.05461085154712E-5
ovarian cancer 8492 6.65841740254541E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.54731841494629E-5
osteosarcoma 7933 1.96376083369703E-4
colon cancer 1475 4.72460935095615E-4
adrenocortical carcinoma 1427 6.01160350173817E-4
Atopic dermatitis 944 8.80920891468319E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00115993800332066
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00145216750693285
primitive neuroectodermal tumor 3031 0.00249966652388374
group 3 medulloblastoma 2254 0.0036443175535408
cutaneous lupus erythematosus 1056 0.00521553751657428
subependymal giant cell astrocytoma 2287 0.0241384751877093
adrenocortical adenoma 134 0.0330849211646274
invasive ductal carcinoma 2950 0.0381633776678007
Disease Target Count Z-score Confidence
Autoimmune hepatitis 13 3.263 1.6

Expression

AA Sequence

MDLSFMAAQLPMMGGAFMDSPNEDFSTEYSLFNSSANVHAAANGQGQPEDPPRSSNDAVLLWIAIIATLG      1 - 70
NIVVVGVVYAFTF                                                              71 - 83
//

Text Mined References (9)

PMID Year Title
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.