Property Summary

NCBI Gene PubMed Count 15
PubMed Score 69.25
PubTator Score 8.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 1.3e-02
cystic fibrosis 1.670 8.8e-05
ductal carcinoma in situ 1.100 3.5e-03
intraductal papillary-mucinous neoplasm ... 1.700 3.0e-04
invasive ductal carcinoma 1.400 5.4e-03
non-small cell lung cancer 1.728 4.4e-15
oligodendroglioma 1.300 4.8e-03
pancreatic cancer 1.400 3.1e-02
primary pancreatic ductal adenocarcinoma 1.597 2.9e-02

Pathway (1)

Gene RIF (5)

AA Sequence

MGLRSWLAAPWGALPPRPPLLLLLLLLLLLQPPPPTWALSPRISLPLGSEERPFLRFEAEHISNYTALLL      1 - 70
SRDGRTLYVGAREALFALSSNLSFLPGGEYQELLWGADAEKKQQCSFKGKDPQRDCQNYIKILLPLSGSH     71 - 140
LFTCGTAAFSPMCTYINMENFTLARDEKGNVLLEDGKGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDP    141 - 210
AISRSQSLRPTKTESSLNWLQDPAFVASAYIPESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARI    211 - 280
CKGDEGGERVLQQRWTSFLKAQLLCSRPDDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHRGTTEG    281 - 350
SAVCVFTMKDVQRVFSGLYKEVNRETQQWYTVTHPVPTPRPGACITNSARERKINSSLQLPDRVLNFLKD    351 - 420
HFLMDGQVRSRMLLLQPQARYQRVAVHRVPGLHHTYDVLFLGTGDGRLHKAVSVGPRVHIIEELQIFSSG    421 - 490
QPVQNLLLDTHRGLLYAASHSGVVQVPMANCSLYRSCGDCLLARDPYCAWSGSSCKHVSLYQPQLATRPW    491 - 560
IQDIEGASAKDLCSASSVVSPSFVPTGEKPCEQVQFQPNTVNTLACPLLSNLATRLWLRNGAPVNASASC    561 - 630
HVLPTGDLLLVGTQQLGEFQCWSLEEGFQQLVASYCPEVVEDGVADQTDEGGSVPVIISTSRVSAPAGGK    631 - 700
ASWGADRSYWKEFLVMCTLFVLAVLLPVLFLLYRHRNSMKVFLKQGECASVHPKTCPVVLPPETRPLNGL    701 - 770
GPPSTPLDHRGYQSLSDSPPGSRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV            771 - 832
//

Text Mined References (18)

PMID Year Title