Property Summary

NCBI Gene PubMed Count 25
Grant Count 51
R01 Count 42
Funding $6,479,702.72
PubMed Score 48.89
PubTator Score 27.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.600 0.000

Gene RIF (8)

PMID Text
25480567 Results confirmed that Ric-8A can directly bind to AGS3S but failed to facilitate Galpha(i)-induced suppression of adenylyl cyclase, suggesting that it may not serve as a guanine exchange factor for AGS3/Galpha(i/o)-GDP complex in a cellular environment.
25074811 Human NCS-1 and Ric8a reproduce the binding and maintain the structural requirements at these key positions. Drosophila Ric8a and Galphas regulate synapse number and neurotransmitter release, and both are functionally linked to Frq2.
24466196 Ric-8A co-localized with Vps34 at the midbody.
23665327 The ubiquitination of Galphai2 and Galphaq is suppressed by expression of Ric-8A. The suppression likely requires Ric-8A interaction with these Galpha proteins; the C-terminal truncation of Galphaq and Galphai2 completely abrogates their interaction with Ric-8A.
22384181 NCAM180 regulates Ric8A membrane localization and potentiates beta-adrenergic response
21880739 RGS14 can form complexes with GPCRs in cells that are dependent on Galpha(i/o) and these RGS14.Galpha(i1).GPCR complexes may be substrates for other signaling partners such as Ric-8A
21771786 Ric-8A is critical for growth factor receptor-induced actin cytoskeletal reorganization
20479129 Ric-8A signaling leads to assembly of a cortical signaling complex that functions to orient the mitotic spindle.

AA Sequence

MEPRAVAEAVETGEEDVIMEALRSYNQEHSQSFTFDDAQQEDRKRLAELLVSVLEQGLPPSHRVIWLQSV      1 - 70
RILSRDRNCLDPFTSRQSLQALACYADISVSEGSVPESADMDVVLESLKCLCNLVLSSPVAQMLAAEARL     71 - 140
VVKLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLLTDTLELTLGVTPEGNPPP    141 - 210
TLLPSQETERAMEILKVLFNITLDSIKGEVDEEDAALYRHLGTLLRHCVMIATAGDRTEEFHGHAVNLLG    211 - 280
NLPLKCLDVLLTLEPHGDSTEFMGVNMDVIRALLIFLEKRLHKTHRLKESVAPVLSVLTECARMHRPARK    281 - 350
FLKAQVLPPLRDVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLL    351 - 420
AARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKL    421 - 490
SRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD                                 491 - 531
//

Text Mined References (38)

PMID Year Title
25480567 2015 Activator of G protein signaling 3 forms a complex with resistance to inhibitors of cholinesterase-8A without promoting nucleotide exchange on G?(i3).
25416956 2014 A proteome-scale map of the human interactome network.
25074811 2014 The guanine-exchange factor Ric8a binds to the Ca²? sensor NCS-1 to regulate synapse number and neurotransmitter release.
24466196 2014 Resistance to inhibitors of cholinesterase (Ric)-8A and G?i contribute to cytokinesis abscission by controlling vacuolar protein-sorting (Vps)34 activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23665327 2013 Ubiquitination of the heterotrimeric G protein ? subunits G?i2 and G?q is prevented by the guanine nucleotide exchange factor Ric-8A.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22384181 2012 NCAM180 regulates Ric8A membrane localization and potentiates ?-adrenergic response.
21880739 2011 G protein-coupled receptors and resistance to inhibitors of cholinesterase-8A (Ric-8A) both regulate the regulator of g protein signaling 14 RGS14·G?i1 complex in live cells.
More...