Property Summary

NCBI Gene PubMed Count 35
Grant Count 140
R01 Count 75
Funding $14,191,240.14
PubMed Score 752.08
PubTator Score 60.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 0.014
hepatocellular carcinoma 1.500 0.000
pancreatic cancer 1.800 0.004
osteosarcoma -4.211 0.000
tuberculosis and treatment for 6 months -1.600 0.003
non-small cell lung cancer -1.870 0.000
lung adenocarcinoma -1.200 0.000
pancreatic carcinoma 1.800 0.004
lung carcinoma -1.900 0.000
mucosa-associated lymphoid tissue lympho... 2.196 0.007

Synonym

Accession Q9NPP4 A8K9F8 B2RBQ3 B3KTF0 D6W580 Q96J81 Q96J82 Q96J83
Symbols CLAN
IPAF
AIFEC
CLAN1
CLANA
CLANB
CLANC
CLAND
FCAS4
CARD12
CLR2.1

Gene

PANTHER Protein Class (2)

Gene RIF (21)

PMID Text
26972847 While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production.
26362438 association of IL-18 levels with a single nucleotide polymorphism in the untranslated exon 2 of the inflammasome component NLRC4
26269955 Thus, pathogenic inflammasome activity during Candida infection is negatively regulated by the IL-22/NLRC4/IL-1Ra axis.
26258904 analysis of a subset of inflammasome receptors including NLRP3, NLRC4 and AIM2 that triggers formation of the micrometer-sized spherical supramolecular complex called the ASC speck
25811392 cN-II co-immunoprecipitated both with wild type Ipaf and its LRR domain after transfection with corresponding expression vectors, but not with Ipaf lacking the LRR domain.
25385754 Data indicate that NLR family CARD domain containing 4 protein (NLRC4) is a causative gene for familial cold autoinflammatory syndrome (FCAS).
25342284 Elevated expression of IPAF was associated with inflammation in patients with pemphigus vulgaris disease.
25217960 Data show that the disease was caused by a de novo gain-of-function mutation in NLR family CARD domain containing 4 (NLRC4) encoding a p.Val341Ala substitution.
24054992 inflammasome (also known as NLRC4) has been demonstrated to play a role in host defense mechanisms against pathogen-associated molecules
23215645 This review describes the surprisingly diverse mechanisms by which NLRC4 senses bacteria and initiates innate immune responses.
More...

AA Sequence

MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILKKGSESCNLFL      1 - 70
KSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLW     71 - 140
RKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQRIAMLWGSGKCKALTKFKFVFFLRLSRAQG    141 - 210
GLFETLCDQLLDIPGTIRKQTFMAMLLKLRQRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTT    211 - 280
TECLRHIRQFGALTAEVGDMTEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMG    281 - 350
ESEFHSHTQTTLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV    351 - 420
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSISDITSTYSSL    421 - 490
LRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNTTEQEILKAININSFVECGIH    491 - 560
LYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED    561 - 630
TGGIHMEEAPETYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGV    631 - 700
AGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIM    701 - 770
DNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL    771 - 840
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLLKHLEEVPQLV    841 - 910
KLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPD    911 - 980
PALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFKLVTA                              981 - 1024
//

Text Mined References (37)

PMID Year Title
26972847 2016 IL-1 receptor antagonist ameliorates inflammasome-dependent inflammation in murine and human cystic fibrosis.
26362438 2015 Molecular Characterization of the NLRC4 Expression in Relation to Interleukin-18 Levels.
26269955 2015 Pathogenic NLRP3 Inflammasome Activity during Candida Infection Is Negatively Regulated by IL-22 via Activation of NLRC4 and IL-1Ra.
26258904 2015 Artificial Loading of ASC Specks with Cytosolic Antigens.
25811392 2015 Cytosolic 5'-nucleotidase II interacts with the leucin rich repeat of NLR family member Ipaf.
25385754 2014 An inherited mutation in NLRC4 causes autoinflammation in human and mice.
25342284 2015 Elevated expression of NLRP1 and IPAF are related to oral pemphigus vulgaris pathogenesis.
25217960 2014 Mutation of NLRC4 causes a syndrome of enterocolitis and autoinflammation.
25217959 2014 An activating NLRC4 inflammasome mutation causes autoinflammation with recurrent macrophage activation syndrome.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
More...