Property Summary

NCBI Gene PubMed Count 41
PubMed Score 814.11
PubTator Score 60.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.200 1.4e-02
hepatocellular carcinoma 1.500 2.5e-04
lung adenocarcinoma -1.200 3.2e-13
lung carcinoma -1.900 1.5e-18
mucosa-associated lymphoid tissue lympho... 2.196 7.2e-03
non-small cell lung cancer -1.870 3.4e-24
osteosarcoma -4.211 1.0e-06
pancreatic cancer 1.800 3.5e-03
pancreatic carcinoma 1.800 3.5e-03
tuberculosis and treatment for 6 months -1.600 2.9e-03

 GWAS Trait (1)

Gene RIF (27)

AA Sequence

MNFIKDNSRALIQRMGMTVIKQITDDLFVWNVLNREEVNIICCEKVEQDAARGIIHMILKKGSESCNLFL      1 - 70
KSLKEWNYPLFQDLNGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLW     71 - 140
RKDQHHHRVEQLTLNGLLQALQSPCIIEGESGKGKSTLLQRIAMLWGSGKCKALTKFKFVFFLRLSRAQG    141 - 210
GLFETLCDQLLDIPGTIRKQTFMAMLLKLRQRVLFLLDGYNEFKPQNCPEIEALIKENHRFKNMVIVTTT    211 - 280
TECLRHIRQFGALTAEVGDMTEDSAQALIREVLIKELAEGLLLQIQKSRCLRNLMKTPLFVVITCAIQMG    281 - 350
ESEFHSHTQTTLFHTFYDLLIQKNKHKHKGVAASDFIRSLDHCGDLALEGVFSHKFDFELQDVSSVNEDV    351 - 420
LLTTGLLCKYTAQRFKPKYKFFHKSFQEYTAGRRLSSLLTSHEPEEVTKGNGYLQKMVSISDITSTYSSL    421 - 490
LRYTCGSSVEATRAVMKHLAAVYQHGCLLGLSIAKRPLWRQESLQSVKNTTEQEILKAININSFVECGIH    491 - 560
LYQESTSKSALSQEFEAFFQGKSLYINSGNIPDYLFDFFEHLPNCASALDFIKLDFYGGAMASWEKAAED    561 - 630
TGGIHMEEAPETYIPSRAVSLFFNWKQEFRTLEVTLRDFSKLNKQDIRYLGKIFSSATSLRLQIKRCAGV    631 - 700
AGSLSLVLSTCKNIYSLMVEASPLTIEDERHITSVTNLKTLSIHDLQNQRLPGGLTDSLGNLKNLTKLIM    701 - 770
DNIKMNEEDAIKLAEGLKNLKKMCLFHLTHLSDIGEGMDYIVKSLSSEPCDLEEIQLVSCCLSANAVKIL    771 - 840
AQNLHNLVKLSILDLSENYLEKDGNEALHELIDRMNVLEQLTALMLPWGCDVQGSLSSLLKHLEEVPQLV    841 - 910
KLGLKNWRLTDTEIRILGAFFGKNPLKNFQQLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPD    911 - 980
PALVRKLSQVLSKLTFLQEARLVGWQFDDDDLSVITGAFKLVTA                              981 - 1024
//

Text Mined References (43)

PMID Year Title