Property Summary

NCBI Gene PubMed Count 23
PubMed Score 4.93
PubTator Score 5.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 0.0 5.0
Disease Target Count P-value
ovarian cancer 8519 1.1e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.200 1.1e-03

Protein-protein Interaction (6)

Gene RIF (5)

AA Sequence

MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRI      1 - 70
SKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGW     71 - 140
RTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQ    141 - 210
KYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVID    211 - 280
KQDKD                                                                     281 - 285
//

Text Mined References (26)

PMID Year Title