Property Summary

NCBI Gene PubMed Count 10
PubMed Score 26.11
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.464 4.7e-03
astrocytoma 1.300 1.7e-19
Astrocytoma, Pilocytic 1.300 2.9e-05
atypical teratoid / rhabdoid tumor 1.700 5.6e-07
ependymoma 1.600 1.3e-10
gastric cancer -1.100 4.2e-02
Gaucher disease type 3 -1.300 6.3e-03
glioblastoma 1.500 2.0e-06
lung carcinoma -1.100 2.0e-17
medulloblastoma 1.200 8.2e-04
medulloblastoma, large-cell 1.400 1.6e-05
oligodendroglioma 1.200 2.9e-02
osteosarcoma 3.539 2.4e-04
ovarian cancer 1.200 7.9e-03
pancreatic cancer -1.100 4.8e-02
pancreatic carcinoma -1.100 4.8e-02
pediatric high grade glioma 1.900 4.1e-06
primitive neuroectodermal tumor 1.100 4.0e-04

AA Sequence

MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSE      1 - 70
FQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWS     71 - 140
SS                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title