Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.78
PubTator Score 4.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer -1.100 0.042
pancreatic cancer -1.100 0.048
oligodendroglioma 1.400 0.000
astrocytoma 1.300 0.000
glioblastoma 2.100 0.001
osteosarcoma 3.539 0.000
posterior fossa group B ependymoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma 1.200 0.001
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.100 0.000
adrenocortical carcinoma 1.690 0.005
pediatric high grade glioma 1.900 0.000
pilocytic astrocytoma 1.300 0.000
pancreatic carcinoma -1.100 0.048
lung carcinoma -1.100 0.000
ovarian cancer 1.200 0.008
Gaucher disease type 3 -1.300 0.006

Gene

AA Sequence

MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSE      1 - 70
FQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWS     71 - 140
SS                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.