Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.78
PubTator Score 4.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
astrocytoma 1493 1.71245198731609E-19
lung carcinoma 2844 1.98128811559435E-17
oligodendroglioma 2849 4.11060835186217E-12
posterior fossa group B ependymoma 1530 3.54275488706695E-10
atypical teratoid / rhabdoid tumor 4369 5.59459396029182E-7
pediatric high grade glioma 2712 4.0636492157037E-6
medulloblastoma, large-cell 6234 1.56803330424139E-5
pilocytic astrocytoma 3086 2.59596331674595E-5
osteosarcoma 7933 2.36030899400554E-4
primitive neuroectodermal tumor 3031 3.96297306434392E-4
medulloblastoma 1524 8.21382278737404E-4
glioblastoma 5572 8.70832123018983E-4
adrenocortical carcinoma 1427 0.00472184690665255
Gaucher disease type 3 76 0.00628850700680414
ovarian cancer 8492 0.00785400370653207
gastric cancer 436 0.0419172930225581
pancreatic cancer 2300 0.0478924549421198
pancreatic carcinoma 567 0.0478924549421201

Expression

  Differential Expression (18)

Disease log2 FC p
gastric cancer -1.100 0.042
pancreatic cancer -1.100 0.048
oligodendroglioma 1.400 0.000
astrocytoma 1.300 0.000
glioblastoma 2.100 0.001
osteosarcoma 3.539 0.000
posterior fossa group B ependymoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma 1.200 0.001
medulloblastoma, large-cell 1.400 0.000
primitive neuroectodermal tumor 1.100 0.000
adrenocortical carcinoma 1.690 0.005
pediatric high grade glioma 1.900 0.000
pilocytic astrocytoma 1.300 0.000
pancreatic carcinoma -1.100 0.048
lung carcinoma -1.100 0.000
ovarian cancer 1.200 0.008
Gaucher disease type 3 -1.300 0.006

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

AA Sequence

MATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSE      1 - 70
FQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWS     71 - 140
SS                                                                        141 - 142
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11073998 2000 TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.