Property Summary

NCBI Gene PubMed Count 29
Grant Count 4
R01 Count 1
Funding $266,578
PubMed Score 42.51
PubTator Score 36.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma -1.070 0.002
cystic fibrosis 1.051 0.001
diabetes mellitus -1.100 0.001
dermatomyositis 1.400 0.000

Synonym

Accession Q9NPJ6 B4DX67 Q53GB4 Q53H68 Q5T912 Q6FHC4 Q6IA79 Q9BS95 Q9NYR5
Symbols ARC36
VDRIP
DRIP36
TRAP36
HSPC126

Gene

Gene RIF (6)

PMID Text
24858910 retinoblastoma RB1 -/- cells cannot survive in the absence of MED4, both in vitro and in orthotopic xenograft models in vivo, therefore identifying MED4 as a survival gene in retinoblastoma.
19411183 Our findings suggest that Vitamin D Receptor polymorphisms may be associated with nasal carriage of S. aureus in individuals with type 1 diabetes.
18976975 Knockdown of MED4 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 4 (MED4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED4 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 4 (MED4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI      1 - 70
HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK     71 - 140
GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG    141 - 210
RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD              211 - 270
//

Text Mined References (34)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24858910 2014 The survival gene MED4 explains low penetrance retinoblastoma in patients with large RB1 deletion.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
21505449 2011 Genotype-phenotype correlations in patients with retinoblastoma and interstitial 13q deletions.
21293490 2011 Mediator is a transducer of amyloid-precursor-protein-dependent nuclear signalling.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
More...