Property Summary

NCBI Gene PubMed Count 30
PubMed Score 43.55
PubTator Score 36.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Endometriosis 540 0.0 0.0
Disease Target Count P-value
dermatomyositis 966 1.4e-04
psoriasis 6694 1.8e-04
cystic fibrosis 1696 8.6e-04
diabetes mellitus 1728 1.2e-03
osteosarcoma 7950 1.9e-03
Disease Target Count Z-score Confidence
Familial Retinoblastoma 4 4.229 2.1

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis 1.051 8.6e-04
dermatomyositis 1.400 1.4e-04
diabetes mellitus -1.100 1.2e-03
osteosarcoma -1.070 1.9e-03
psoriasis 1.800 1.8e-04

Gene RIF (6)

AA Sequence

MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLI      1 - 70
HRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARK     71 - 140
GAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG    141 - 210
RLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD              211 - 270
//

Text Mined References (35)

PMID Year Title