Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 6
Funding $382,410.91
PubMed Score 3.46
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (4)

PMID Text
25775514 GR and PNRC2 interact in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation
23085078 PNRC2 acts in synergy with Dcp1a to stimulate the decapping activity of Dcp2 by bridging the interaction between Dcp1a and Dcp2.
19150429 PNRC2 plays an essential role in mammalian Nonsense-mediated mRNA decay (NMD), mediating the interaction between the NMD machinery and the decapping complex.
14651967 Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis.

AA Sequence

MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPN      1 - 70
NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV      71 - 139
//

Text Mined References (14)

PMID Year Title
25775514 2015 Glucocorticoid receptor interacts with PNRC2 in a ligand-dependent manner to recruit UPF1 for rapid mRNA degradation.
25416956 2014 A proteome-scale map of the human interactome network.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23085078 2012 Structural basis of the PNRC2-mediated link between mrna surveillance and decapping.
19150429 2009 Human proline-rich nuclear receptor coregulatory protein 2 mediates an interaction between mRNA surveillance machinery and decapping complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651967 2003 Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma.
More...