Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.14
PubTator Score 4.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.011 1.4e-06
aldosterone-producing adenoma -1.154 1.3e-02
dermatomyositis 1.100 2.9e-03
intraductal papillary-mucinous carcinoma... 1.100 7.3e-04
Multiple myeloma 1.451 2.4e-03
non-small cell lung cancer -1.017 4.8e-23
osteosarcoma 2.800 2.6e-07
ovarian cancer -2.500 1.5e-08
Polycystic ovary syndrome 1.032 3.3e-02
Waldenstrons macroglobulinemia 1.475 1.4e-02

Gene RIF (4)

AA Sequence

MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPN      1 - 70
NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFNPSDKEIMTFQLKTLLKVQV      71 - 139
//

Text Mined References (14)

PMID Year Title