Property Summary

NCBI Gene PubMed Count 20
PubMed Score 159.92
PubTator Score 24.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.500 4.2e-02
astrocytic glioma -1.200 4.6e-02
group 4 medulloblastoma -1.400 4.5e-04
medulloblastoma, large-cell -2.400 1.5e-06
pancreatic ductal adenocarcinoma liver m... -1.990 1.1e-03
psoriasis -1.400 1.0e-03
tuberculosis and treatment for 6 months -1.200 7.3e-03
ulcerative colitis -1.200 1.3e-05

Gene RIF (10)

AA Sequence

MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM      1 - 70
ALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN     71 - 140
//

Text Mined References (26)

PMID Year Title