Property Summary

NCBI Gene PubMed Count 19
PubMed Score 151.34
PubTator Score 24.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.49044333144403E-6
ulcerative colitis 2087 1.25774290619615E-5
group 4 medulloblastoma 1875 4.48320451978107E-4
psoriasis 6685 0.00101228091690904
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00105767192372214
tuberculosis and treatment for 6 months 686 0.0073147223580421
acute myeloid leukemia 785 0.0419563346407146
astrocytic glioma 2241 0.0456453701098211
Disease Target Count Z-score Confidence
Dyslexia 36 4.208 2.1
Cutaneous anthrax 8 3.637 1.8
Diphyllobothriasis 6 3.345 1.7

Expression

  Differential Expression (8)

Synonym

Accession Q9NPJ3 F5H2L4 O95549 Acyl-CoA thioesterase 13
Symbols HT012
THEM2
PNAS-27

Gene

PDB

2F0X   2H4U   3F5O  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
C. elegans OMA Inparanoid

Gene RIF (9)

PMID Text
24894958 This study models the reaction of the hTHEM2 enzyme by first-principles methods to elucidate atomic and electronic details of the mechanism, its transition-state (TS) conformation, and the free-energy landscape of the process.
23954868 study failed to show any association of THEM2 SNPs with developmental dyslexia in an Indian population.
22262880 The results of this study confirmed that both FOXP2 and KIAA0319/TTRAP/THEM2 genes play an important role in human language development, but probably through different cerebral pathways.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19170545 The physiological role of hTHEM2 involves catalysis of the hydrolysis of cytosolic medium-to-long-chain acyl-CoA thioesters.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17704541 Yeast two-hybrid screening using libraries prepared from mouse liver and embryo identified Them2 (thioesterase superfamily member 2) and the homeodomain transcription factor Pax3 (paired box gene 3), respectively, as PC-TP-interacting proteins.
17045243 Small interference RNA silencing in cell line HCT116 shows that the hthem2 gene is essential for the cell sustained proliferation.
16934754 analysis of human thioesterase superfamily member 2 crystal structure

AA Sequence

MTSMTQSLREVIKAMTKARNFERVLGKITLVSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTM      1 - 70
ALLCTERGAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN     71 - 140
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24894958 2014 Molecular mechanism of a hotdog-fold acyl-CoA thioesterase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954868 2013 Lack of association between genetic polymorphisms in ROBO1, MRPL19/C2ORF3 and THEM2 with developmental dyslexia.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22262880 2012 Genetic variants of FOXP2 and KIAA0319/TTRAP/THEM2 locus are associated with altered brain activation in distinct language-related regions.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
More...