Property Summary

NCBI Gene PubMed Count 29
PubMed Score 33.64
PubTator Score 22.08

Knowledge Summary

Patent (1,927)

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -1.300 4.8e-02
Astrocytoma, Pilocytic 1.600 8.4e-04
atypical teratoid / rhabdoid tumor -4.200 5.8e-08
Breast cancer -4.400 3.2e-122
breast carcinoma -1.200 4.0e-03
chronic rhinosinusitis -2.558 3.4e-03
cystic fibrosis and chronic rhinosinusit... -2.478 1.4e-02
ductal carcinoma in situ -1.100 8.9e-03
ependymoma -2.500 5.5e-05
gastric carcinoma -4.600 3.5e-02
group 3 medulloblastoma -3.200 4.3e-05
intraductal papillary-mucinous adenoma (... -5.500 1.8e-06
intraductal papillary-mucinous carcinoma... -5.700 5.0e-07
intraductal papillary-mucinous neoplasm ... -4.900 8.6e-04
invasive ductal carcinoma -1.200 3.6e-02
lung cancer 6.700 7.8e-08
malignant mesothelioma 2.200 1.1e-05
medulloblastoma, large-cell -3.900 4.0e-06
nephrosclerosis -1.066 1.2e-02
oligodendroglioma 1.600 1.5e-02
pancreatic cancer -2.300 3.1e-03
pituitary cancer -1.800 1.5e-02
primary Sjogren syndrome -1.100 6.6e-03
primitive neuroectodermal tumor -2.200 4.3e-02
psoriasis -1.300 5.0e-04
subependymal giant cell astrocytoma -2.733 1.0e-02

 MGI Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MSYYGSSYHIINADAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVDIFTTLVDTKW      1 - 70
RHMFVIFSLSYILSWLIFGSVFWLIAFHHGDLLNDPDITPCVDNVHSFTGAFLFSLETQTTIGYGYRCVT     71 - 140
EECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQTIRFSYFALIGMRDGKLCLMWRIGDFRPNH    141 - 210
VVEGTVRAQLLRYTEDSEGRMTMAFKDLKLVNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILV    211 - 280
TFIYTGDSTGTSHQSRSSYVPREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQ    281 - 350
LHIEKAPPVRESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRETPYQKALLTLNRISVESQM      351 - 418
//

Text Mined References (30)

PMID Year Title