Property Summary

NCBI Gene PubMed Count 38
Grant Count 6
Funding $212,209.1
PubMed Score 35.52
PubTator Score 44.53

Knowledge Summary

Patent

No data available

Gene RIF (18)

PMID Text
26385482 Using small interfering RNA (siRNA), knockdown of FANCF, FANCL, or FANCD2 inhibited function of the FA/BRCA pathway in A549, A549/DDP and SK-MES-1 cells, and potentiated sensitivity of the three cells to cisplatin.
26033879 careful examination of three electively aborted fetuses in one family and one affected girl in the other indicated an association of the FANCF loss-of-function mutation with a severe phenotype characterized by multiple malformations
24996439 Data suggest that the Fanconi anemia group F protein/BRCA1/2 proteins pathway may be a new target to reverse adriamycin (ADR) resistance in leukemia treatment.
23440494 Silencing of FANCF enhanced the antiproliferative effect of ADM in OVCAR3 cells.
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19813073 FANCF methylation is a rare event in Japanese primary invasive breast cancer.
19801548 Data identify the gene encoding Fanconi F (FANCF) as an ICSBP target gene.
19690177 Observational study of gene-disease association. (HuGE Navigator)
19536649 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEG      1 - 70
GFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRR     71 - 140
SAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALL    141 - 210
QPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTD    211 - 280
WGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDL    281 - 350
LLALRSGAFRKRQVLGLSAGLSSV                                                  351 - 374
//

Text Mined References (37)

PMID Year Title
26385482 2015 RNA interferences targeting the Fanconi anemia/BRCA pathway upstream genes reverse cisplatin resistance in drug-resistant lung cancer cells.
26033879 2015 Clinical aspects of Fanconi anemia individuals with the same mutation of FANCF identified by next generation sequencing.
24996439 2015 The Fanconi anemia/BRCA pathway is involved in DNA interstrand cross-link repair of adriamycin-resistant leukemia cells.
23440494 2013 RNA interference-mediated FANCF silencing sensitizes OVCAR3 ovarian cancer cells to adriamycin through increased adriamycin-induced apoptosis dependent on JNK activation.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20347428 2010 A histone-fold complex and FANCM form a conserved DNA-remodeling complex to maintain genome stability.
19813073 2011 Low incidence of methylation of the promoter region of the FANCF gene in Japanese primary breast cancer.
19801548 2009 The interferon consensus sequence binding protein (ICSBP/IRF8) activates transcription of the FANCF gene during myeloid differentiation.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
More...