Property Summary

Ligand Count 1
NCBI Gene PubMed Count 40
PubMed Score 37.15
PubTator Score 44.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Anemia 365 5.02 2.5
Cancer 2499 3.179 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 8.9e-08
ependymoma 1.100 2.5e-06
glioblastoma 1.100 7.7e-05
group 3 medulloblastoma 2.400 7.7e-06
hepatocellular carcinoma 1.100 5.7e-05
lung cancer 2.000 6.7e-04
lung carcinoma 1.100 1.3e-11
medulloblastoma, large-cell 1.300 2.6e-04
osteosarcoma -2.190 4.0e-06
primitive neuroectodermal tumor 1.300 5.7e-04
Rheumatoid arthritis -1.300 3.2e-03

Gene RIF (20)

AA Sequence

MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEG      1 - 70
GFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRR     71 - 140
SAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALL    141 - 210
QPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTD    211 - 280
WGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDL    281 - 350
LLALRSGAFRKRQVLGLSAGLSSV                                                  351 - 374
//

Text Mined References (39)

PMID Year Title