Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.031 1.6e-05
aldosterone-producing adenoma -1.158 2.8e-02
Breast cancer 3.200 3.0e-02
colon cancer -2.100 4.9e-02
Down syndrome 1.300 3.2e-04
gastric cancer 1.200 7.8e-03
glioblastoma 1.100 2.6e-03
hepatocellular carcinoma 1.400 2.0e-05
hereditary spastic paraplegia -1.091 7.3e-03
juvenile dermatomyositis 1.102 1.9e-10
lung cancer -1.100 1.3e-02
osteosarcoma 1.070 2.3e-02
ovarian cancer 1.800 7.9e-04
posterior fossa group B ependymoma 1.100 1.1e-05
primary Sjogren syndrome 1.100 1.8e-02
tuberculosis -1.300 7.3e-03
ulcerative colitis -1.100 3.8e-06

Synonym

Accession Q9NPI7 Q3B7J7
Symbols CHBP2

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (2)

 GO Component (1)

 Compartment GO Term (2)

AA Sequence

MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQT      1 - 70
YPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHF     71 - 140
SSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVS    141 - 210
TEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF                         211 - 259
//

Text Mined References (7)

PMID Year Title