Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
gastric cancer 1.200 0.008
hepatocellular carcinoma 1.400 0.000
osteosarcoma 1.070 0.023
glioblastoma 1.100 0.003
hereditary spastic paraplegia -1.091 0.007
juvenile dermatomyositis 1.187 0.000
acute quadriplegic myopathy 1.031 0.000
tuberculosis and treatment for 6 months -2.500 0.000
colon cancer -2.100 0.049
lung cancer -2.100 0.000
Breast cancer 3.200 0.030
posterior fossa group B ependymoma 1.100 0.000
primary Sjogren syndrome 1.100 0.018
aldosterone-producing adenoma -1.235 0.024
ulcerative colitis -1.100 0.000
ovarian cancer 1.900 0.000
Down syndrome 1.300 0.000

Synonym

Accession Q9NPI7 Q3B7J7
Symbols CHBP2

Gene

 Compartment GO Term (0)

AA Sequence

MKHSKKTYDSFQDELEDYIKVQKARGLEPKTCFRKMKGDYLETCGYKGEVNSRPTYRMFDQRLPSETIQT      1 - 70
YPRSCNIPQTVENRLPQWLPAHDSRLRLDSLSYCQFTRDCFSEKPVPLNFNQQEYICGSHGVEHRVYKHF     71 - 140
SSDNSTSTHQASHKQIHQKRKRHPEEGREKSEEERSKHKRKKSCEEIDLDKHKSIQRKKTEVEIETVHVS    141 - 210
TEKLKNRKEKKSRDVVSKKEERKRTKKKKEQGQERTEEEMLWDQSILGF                         211 - 259
//

Text Mined References (7)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
19414484 2009 Genome-wide association meta-analysis for total serum bilirubin levels.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.