Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.00
PubTator Score 24.52

Knowledge Summary

Patent

No data available

Synonym

Accession Q9NPI6 B4DHN9 U3KQM8
Symbols SMIF
SMAD4IP1
HSA275986
Nbla00360

Gene

PDB

2WX3   4B6H  

Gene RIF (13)

PMID Text
25970328 The assembly of EDC4 and Dcp1a into processing bodies is critical for the translational regulation of IL-6.
25796077 Phosphorylation at serine 315, serine 319, and threonine 321 of DCP1A modulates IL-8 expression during respiratory syncytial virus infection.
24510189 The data indicates that DCP2 activation by DCP1 occurs preferentially on the EDC4 scaffold, which may serve to couple DCP2 activation by DCP1 with 5'-to-3' mRNA degradation by XRN1 in human cells.
23926332 The efficiency of incorporation of Mov10, A3G, and A3F into viral particles, which contains both HIV-1 Gag and genomic RNA, is much higher than that of the other P-body proteins AGO2, DCP1a, DCP2, and DDX6
23300942 hDcp1a has a role in control of processing body dynamics during the cell cycle via phosphorylation
23131811 Malin regulates the recruitment of mRNA-decapping enzyme 1A (Dcp1a) to processing bodies.
23085078 PNRC2 acts in synergy with Dcp1a to stimulate the decapping activity of Dcp2 by bridging the interaction between Dcp1a and Dcp2.
21948796 The efficiency of incorporation of Mov10, A3G, and A3F into viral particles, which contains both HIV-1 Gag and genomic RNA, is much higher than that of the other P-body proteins AGO2, DCP1a, DCP2, and DDX6
21859862 Reveal DCP1a as a multifunctional regulator of mRNA expression and suggest a role for JNK kinase phosphorylation in controlling the subcellular localization of DCP1a in response to stress or inflammatory stimuli.
19812249 Data show the presence of P-body-like foci in mouse oocytes, as revealed by the presence of Dcp1a and the colocalization of RNA-associated protein 55 (RAP55) and the DEAD box RNA helicase Rck/p54.
More...

AA Sequence

MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV      1 - 70
NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK     71 - 140
QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA    141 - 210
PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA    211 - 280
HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR    281 - 350
QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS    351 - 420
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIQVAGAPLV    421 - 490
TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS    491 - 560
FLSTLHEVYLQVLTKNKDNHNL                                                    561 - 582
//

Text Mined References (53)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25970328 2015 The Assembly of EDC4 and Dcp1a into Processing Bodies Is Critical for the Translational Regulation of IL-6.
25796077 2015 Decapping protein 1 phosphorylation modulates IL-8 expression during respiratory syncytial virus infection.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
More...