Property Summary

NCBI Gene PubMed Count 47
PubMed Score 0.00
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.100 3.1e-02
astrocytoma 1.100 5.5e-03
group 3 medulloblastoma 1.100 3.9e-03
lung adenocarcinoma -1.100 1.8e-11
lung carcinoma -1.200 2.8e-09
non-small cell lung carcinoma -1.200 4.6e-30
osteosarcoma -1.274 1.1e-04
ovarian cancer -1.200 3.2e-05

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIV      1 - 70
NRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDK     71 - 140
QSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSA    141 - 210
PSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAA    211 - 280
HHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR    281 - 350
QRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVAS    351 - 420
FSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIQVAGAPLV    421 - 490
TATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSS    491 - 560
FLSTLHEVYLQVLTKNKDNHNL                                                    561 - 582
//

Text Mined References (60)

PMID Year Title