Property Summary

NCBI Gene PubMed Count 9
PubMed Score 78.95
PubTator Score 19.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6514 6.5e-05
dermatomyositis 941 9.5e-03
aldosterone-producing adenoma 646 1.1e-02
Disease Target Count Z-score Confidence
Macular degeneration 64 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma 1.293 1.1e-02
dermatomyositis -1.300 9.5e-03
psoriasis -1.700 6.5e-05

AA Sequence

MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMEAMLDTVQ      1 - 70
AWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPD     71 - 140
PPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQG    141 - 210
PGRGCGHRTARPAASQQDSM                                                      211 - 230
//

Text Mined References (10)

PMID Year Title