Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $149,959
PubMed Score 68.70
PubTator Score 19.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
aldosterone-producing adenoma 1.293 0.011
dermatomyositis -1.300 0.010
psoriasis -1.700 0.000

AA Sequence

MKLIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGEDGFKQWDVLESLDMEAMLDTVQ      1 - 70
AWLSSPQKFARAHGVSVQPEASDTHILLLEGFLLYSYKPLVDLYSRRYFLTVPYEECKWRRSTRNYTVPD     71 - 140
PPGLFDGHVWPMYQKYRQEMEANGVEVVYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQG    141 - 210
PGRGCGHRTARPAASQQDSM                                                      211 - 230
//

Text Mined References (10)

PMID Year Title
17914902 2007 Nicotinamide riboside kinase structures reveal new pathways to NAD+.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15137942 2004 Discoveries of nicotinamide riboside as a nutrient and conserved NRK genes establish a Preiss-Handler independent route to NAD+ in fungi and humans.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941630 2003 The muscle integrin binding protein (MIBP) interacts with alpha7beta1 integrin and regulates cell adhesion and laminin matrix deposition.
12809483 2003 ST7 is a novel low-density lipoprotein receptor-related protein (LRP) with a cytoplasmic tail that interacts with proteins related to signal transduction pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10613898 1999 A novel muscle-specific beta 1 integrin binding protein (MIBP) that modulates myogenic differentiation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.