Property Summary

NCBI Gene PubMed Count 42
Grant Count 10
R01 Count 4
Funding $675,891.2
PubMed Score 49.80
PubTator Score 39.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (30)

PMID Text
27010857 the expression of miR-141 in BRD7-overexpressing NPC cells could partially reverse the tumor suppressive effect of BRD7 on cell proliferation and tumor growth in vitro and in vivo.
26620707 Propose that the balance between BRD7 function and Ras/Raf/MEK/ERK activity is important for determining the outcomes of HCV infection and HCC development.
26407966 constructed a regulating network of BRD7 downstream genes, and this network suggests multiple feedback regulations of the pathways. Furthermore, we validated BIRC2, BIRC3, TXN2, and NOTCH1 genes as direct, functional BRD7 targets
26149213 Data indicate that bromodomain-containing protein 7 (BRD7) was a direct target of microRNA-410 (miR-410).
26010572 Ectopic expression of BRD7 could significantly inhibit miR-300-promoted proliferation, invasion and epithelial-mesenchymal transition in osteosarcoma.
25743841 BRD7 promoter hypermethylation is an indicator of well differentiated oral squamous cell carcinomas.
24840027 lower BRD7 expression is an indicator for poor prognosis in patients with osteosarcoma.
24657164 BRD7-mediated translocation of a subfraction (but not all) of the p85 protein to the nucleus could enhance PI3K signaling.
24404152 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
24198243 These results suggested that BRD7 acts as a tumor suppressor in epithelial ovarian cancers
More...

AA Sequence

MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGE      1 - 70
KQIPGEEKGRKRRRVKEDKKKRDRDRVENEAEKDLQCHAPVRLDLPPEKPLTSSLAKQEEVEQTPLQEAL     71 - 140
NQLMRQLQRKDPSAFFSFPVTDFIAPGYSMIIKHPMDFSTMKEKIKNNDYQSIEELKDNFKLMCTNAMIY    141 - 210
NKPETIYYKAAKKLLHSGMKILSQERIQSLKQSIDFMADLQKTRKQKDGTDTSQSGEDGGCWQREREDSG    211 - 280
DAEAHAFKSPSKENKKKDKDMLEDKFKSNNLEREQEQLDRIVKESGGKLTRRLVNSQCEFERRKPDGTTT    281 - 350
LGLLHPVDPIVGEPGYCPVRLGMTTGRLQSGVNTLQGFKEDKRNKVTPVLYLNYGPYSSYAPHYDSTFAN    351 - 420
ISKDDSDLIYSTYGEDSDLPSDFSIHEFLATCQDYPYVMADSLLDVLTKGGHSRTLQEMEMSLPEDEGHT    421 - 490
RTLDTAKEMEITEVEPPGRLDSSTQDRLIALKAVTNFGVPVEVFDSEEAEIFQKKLDETTRLLRELQEAQ    491 - 560
NERLSTRPPPNMICLLGPSYREMHLAEQVTNNLKELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVD    561 - 630
LTEDTEEPKKTDVAECGPGGS                                                     631 - 651
//

Text Mined References (51)

PMID Year Title
27010857 2016 miR-141 is involved in BRD7-mediated cell proliferation and tumor formation through suppression of the PTEN/AKT pathway in nasopharyngeal carcinoma.
26620707 2016 Bromodomain containing protein represses the Ras/Raf/MEK/ERK pathway to attenuate human hepatoma cell proliferation during HCV infection.
26407966 2016 Integrating ChIP-sequencing and digital gene expression profiling to identify BRD7 downstream genes and construct their regulating network.
26149213 2015 MicroRNA-410 promotes cell proliferation by targeting BRD7 in non-small cell lung cancer.
26010572 2015 Up-Regulation of MiR-300 Promotes Proliferation and Invasion of Osteosarcoma by Targeting BRD7.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25743841 2015 BRD7 promoter hypermethylation as an indicator of well differentiated oral squamous cell carcinomas.
24840027 2014 Targeting the anaphase-promoting complex/cyclosome (APC/C)- bromodomain containing 7 (BRD7) pathway for human osteosarcoma.
24657164 2014 BRD7, a tumor suppressor, interacts with p85? and regulates PI3K activity.
24404152 2014 Disturbing miR-182 and -381 inhibits BRD7 transcription and glioma growth by directly targeting LRRC4.
More...