Property Summary

NCBI Gene PubMed Count 30
PubMed Score 36.75
PubTator Score 33.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.4e-103
Atopic dermatitis 952 6.8e-05
cystic fibrosis 1696 3.5e-04
group 3 medulloblastoma 4104 8.2e-03
interstitial cystitis 2312 3.0e-02
Disease Target Count Z-score Confidence
ulcerative colitis 1819 0.0 2.3
Disease Target Count Z-score Confidence
Crohn's disease 321 3.585 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 4.500 5.4e-103
Atopic dermatitis 1.200 6.8e-05
cystic fibrosis -1.727 3.5e-04
group 3 medulloblastoma 1.900 8.2e-03
interstitial cystitis 1.500 3.0e-02

Synonym

Accession Q9NPH9 IL-26
Symbols AK155
IL-26

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

AA Sequence

MLVNFILRCGLLLVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIKNIRLLKKK      1 - 70
TKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVEDFHSLRQKLSHCISCASSAREMKSITRMKRI     71 - 140
FYRIGNKGIYKAISELDILLSWIKKLLESSQ                                           141 - 171
//

Text Mined References (30)

PMID Year Title