Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.91
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.6e-15

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.700 8.6e-15

AA Sequence

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMR      1 - 70
EDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREAL     71 - 140
EEFKKLVQRKGLSEEDIFTPLQTGSCVPEH                                            141 - 170
//

Text Mined References (8)

PMID Year Title