Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.91
PubTator Score 2.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

AA Sequence

MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGKLEATFTFMR      1 - 70
EDRCIQKKILMRKTEEPGKYSAYGGRKLMYLQELPRRDHYIFYCKDQHHGGLLHMGKLVGRNSDTNREAL     71 - 140
EEFKKLVQRKGLSEEDIFTPLQTGSCVPEH                                            141 - 170
//

Text Mined References (8)

PMID Year Title
23267103 2013 Linkage analysis identifies a locus for plasma von Willebrand factor undetected by genome-wide association.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044155 2002 Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties.
10607840 2000 A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres.
3388043 1988 Molecular cloning of odorant-binding protein: member of a ligand carrier family.