Property Summary

NCBI Gene PubMed Count 215
Grant Count 303
R01 Count 207
Funding $27,314,617.96
PubMed Score 658.58
PubTator Score 374.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NPH5 A8K715 B7Z520 E7EMD7 Q5K3R4 Q5K3R5 Q5K3R6 Q5K3R8 Q7Z7G3 Q86V92
Symbols KOX
KOX-1
RENOX

Gene

PANTHER Protein Class (2)

Gene RIF (211)

PMID Text
27509686 A deep understanding of Nox4 structure/function and mechanisms of regulation could lead both to the identification of new therapeutic targets and to the development of innovative strategies for appropriate osteoarthritis treatment. [review]
26861875 An endogenous NOX4 forms macromolecular complexes with calnexin, which are needed for the proper maturation, processing, and function of NOX4 in the endoplasmic reticulum.
26742780 The reactive oxygen species-generating NADPH oxidase-4 (Nox4) is induced downstream of ATF4, binds to a PP1-targeting subunit GADD34 at the endoplasmic reticulum, and inhibits PP1 activity to increase eIF2alpha phosphorylation and ATF4 levels.
26715682 H2O2-forming NOX4, unlike the superoxide-forming NOX1, can act as a negative modulator of inflammation and remodeling and convey atheroprotection.
26620565 Nox4 is a positive transcriptional regulator of cystathionine-gamma-lyase in endothelial cells.
26582463 Downregulation of smooth muscle Nox4 inhibits neointimal hyperplasia by suppressing TSP1.
26572549 The angiogenic effect of TRAIL on human microvascular endothelial cell-1 cells is downstream of fibroblast growth factor-2, involving NOX4 and nitric oxide signaling.
26521743 Expression of NOX4/p22(phox) as well as ROS production is enhanced by IL-1beta. On the other hand, the use of NOX4 inhibitors decreased IL-1beta-induced collagenase synthesis by chondrocytes.
26473288 High expression of NOX4 is associated with metastasis in prostate cancer.
26408539 Fluid shear stress regulates PLGF expression via NADPH oxidase 4 and reactive oxygen species signaling.
More...

AA Sequence

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSL      1 - 70
ILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVE     71 - 140
LNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSG    141 - 210
GLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANF    211 - 280
PQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALE    281 - 350
NHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES    351 - 420
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPD    421 - 490
YVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLS    491 - 560
NQNNSYGTRFEYNKESFS                                                        561 - 578
//

Text Mined References (216)

PMID Year Title
27509686 [NADPH oxidase Nox4, a putative therapeutic target in osteoarthritis].
26861875 2016 The Endoplasmic Reticulum Chaperone Calnexin Is a NADPH Oxidase NOX4 Interacting Protein.
26742780 2016 Targeted redox inhibition of protein phosphatase 1 by Nox4 regulates eIF2?-mediated stress signaling.
26715682 2016 Reactive Oxygen Species Can Provide Atheroprotection via NOX4-Dependent Inhibition of Inflammation and Vascular Remodeling.
26620565 2016 Transcriptional Regulation of Cystathionine-?-Lyase in Endothelial Cells by NADPH Oxidase 4-Dependent Signaling.
26582463 2015 Role of smooth muscle Nox4-based NADPH oxidase in neointimal hyperplasia.
26572549 2015 Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Promotes Angiogenesis and Ischemia-Induced Neovascularization Via NADPH Oxidase 4 (NOX4) and Nitric Oxide-Dependent Mechanisms.
26521743 2015 IL-1beta mediates MMP secretion and IL-1beta neosynthesis via upregulation of p22(phox) and NOX4 activity in human articular chondrocytes.
26473288 2015 Endosomal gene expression: a new indicator for prostate cancer patient prognosis?
26408539 2015 Fluid shear stress upregulates placental growth factor in the vessel wall via NADPH oxidase 4.
More...