Property Summary

NCBI Gene PubMed Count 215
PubMed Score 658.58
PubTator Score 374.26

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NPH5 A8K715 B7Z520 E7EMD7 Q5K3R4 Q5K3R5 Q5K3R6 Q5K3R8 Q7Z7G3 Q86V92
Symbols KOX
KOX-1
RENOX

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (209)

PMID Text
27509686 A deep understanding of Nox4 structure/function and mechanisms of regulation could lead both to the identification of new therapeutic targets and to the development of innovative strategies for appropriate osteoarthritis treatment. [review]
26861875 An endogenous NOX4 forms macromolecular complexes with calnexin, which are needed for the proper maturation, processing, and function of NOX4 in the endoplasmic reticulum.
26742780 The reactive oxygen species-generating NADPH oxidase-4 (Nox4) is induced downstream of ATF4, binds to a PP1-targeting subunit GADD34 at the endoplasmic reticulum, and inhibits PP1 activity to increase eIF2alpha phosphorylation and ATF4 levels.
26715682 H2O2-forming NOX4, unlike the superoxide-forming NOX1, can act as a negative modulator of inflammation and remodeling and convey atheroprotection.
26620565 Nox4 is a positive transcriptional regulator of cystathionine-gamma-lyase in endothelial cells.
26582463 Downregulation of smooth muscle Nox4 inhibits neointimal hyperplasia by suppressing TSP1.
26572549 The angiogenic effect of TRAIL on human microvascular endothelial cell-1 cells is downstream of fibroblast growth factor-2, involving NOX4 and nitric oxide signaling.
26521743 Expression of NOX4/p22(phox) as well as ROS production is enhanced by IL-1beta. On the other hand, the use of NOX4 inhibitors decreased IL-1beta-induced collagenase synthesis by chondrocytes.
26473288 High expression of NOX4 is associated with metastasis in prostate cancer.
26408539 Fluid shear stress regulates PLGF expression via NADPH oxidase 4 and reactive oxygen species signaling.
More...

AA Sequence

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSL      1 - 70
ILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVE     71 - 140
LNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSG    141 - 210
GLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANF    211 - 280
PQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALE    281 - 350
NHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES    351 - 420
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPD    421 - 490
YVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLS    491 - 560
NQNNSYGTRFEYNKESFS                                                        561 - 578
//

Text Mined References (216)

PMID Year Title
27509686 [NADPH oxidase Nox4, a putative therapeutic target in osteoarthritis].
26861875 2016 The Endoplasmic Reticulum Chaperone Calnexin Is a NADPH Oxidase NOX4 Interacting Protein.
26742780 2016 Targeted redox inhibition of protein phosphatase 1 by Nox4 regulates eIF2?-mediated stress signaling.
26715682 2016 Reactive Oxygen Species Can Provide Atheroprotection via NOX4-Dependent Inhibition of Inflammation and Vascular Remodeling.
26620565 2016 Transcriptional Regulation of Cystathionine-?-Lyase in Endothelial Cells by NADPH Oxidase 4-Dependent Signaling.
26582463 2015 Role of smooth muscle Nox4-based NADPH oxidase in neointimal hyperplasia.
26572549 2015 Tumor Necrosis Factor-Related Apoptosis-Inducing Ligand (TRAIL) Promotes Angiogenesis and Ischemia-Induced Neovascularization Via NADPH Oxidase 4 (NOX4) and Nitric Oxide-Dependent Mechanisms.
26521743 2015 IL-1beta mediates MMP secretion and IL-1beta neosynthesis via upregulation of p22(phox) and NOX4 activity in human articular chondrocytes.
26473288 2015 Endosomal gene expression: a new indicator for prostate cancer patient prognosis?
26408539 2015 Fluid shear stress upregulates placental growth factor in the vessel wall via NADPH oxidase 4.
More...