Property Summary

NCBI Gene PubMed Count 65
PubMed Score 49.73
PubTator Score 52.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 2.200 0.000
tuberculosis -1.800 0.004
pancreatic ductal adenocarcinoma liver m... -1.349 0.004
non-small cell lung cancer 1.088 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.000
lung cancer -2.200 0.000
pancreatic cancer 1.600 0.000
adult high grade glioma 2.100 0.000
pilocytic astrocytoma 3.500 0.000
lung carcinoma -2.400 0.000
spina bifida -1.085 0.043
ovarian cancer 1.200 0.014

Synonym

Accession Q9NPH3 B1NLD0 D3DNW0 O14915 Q86WJ7 IL-1 receptor accessory protein
Symbols IL1R3
C3orf13
IL-1RAcP

Gene

PDB

4DEP   3O4O  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (37)

PMID Text
26268530 The findings of this study support IL1RAP as a novel potential Alzheimer's disease target and highlight the use of amyloid PET as a valuable Alzheimer's disease endophenotype, particularly in a longitudinal framework.
25517029 The SNP rs4624606 in IL-1RAcP was nominally associated with CAD risk.
24935223 Data suggest serum levels of soluble IL1RAP (from alternative splicing) are down-regulated in endometriosis throughout menstrual cycle; IL1RAP levels (which peak in proliferative phase in fertile women) exhibit minor variations in endometriosis.
24915116 Plasma sIL1RAP levels are reduced in obesity and can potentially act as biomarkers of obesity.
23980170 Combined crystallography and small-angle X-ray-scattering studies reveal that ST2 possesses hinge flexibility between the D3 domain and D1D2 module, whereas IL-1RAcP exhibits a rigid conformation in the unbound state in solution.
22904187 MARCH8-mediated polyubiquitination and degradation of IL1RAP is an important mechanism for negative regulation of IL-1beta-induced signaling pathways.
22778412 Interleukin-1R3 mediates interleukin-1-induced potassium current increase through fast activation of Akt kinase.
22723552 Knockdown of IL1RAP decreased clonogenicity and increased cell death of AML cells.
22251538 The genetic polymorphisms of IL-1ss-2023 C allele, IL- 1RAcP -8261 T allele and -8183 A allele are probable host factors for persistent HBV infection.
21958553 decreased protein levels in the peritoneal fluid of women with endometriosis
More...

AA Sequence

MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW      1 - 70
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS     71 - 140
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY    141 - 210
TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV    211 - 280
WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK    281 - 350
VPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF    351 - 420
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENM    421 - 490
ASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQ    491 - 560
GLSYSSLKNV                                                                561 - 570
//

Text Mined References (75)

PMID Year Title
26268530 2015 GWAS of longitudinal amyloid accumulation on 18F-florbetapir PET in Alzheimer's disease implicates microglial activation gene IL1RAP.
25595648 2015 Increased IL-33 expression in chronic obstructive pulmonary disease.
25517029 2014 Associations between variants in IL-33/ST2 signaling pathway genes and coronary heart disease risk.
24935223 2014 Blood soluble interleukin 1 receptor accessory protein levels are consistently low throughout the menstrual cycle of women with endometriosis.
24915116 2014 Plasma levels of soluble interleukin 1 receptor accessory protein are reduced in obesity.
23980170 2013 Structural insights into the interaction of IL-33 with its receptors.
23479569 2013 Selective killing of candidate AML stem cells by antibody targeting of IL1RAP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22904187 2012 The E3 ubiquitin ligase MARCH8 negatively regulates IL-1?-induced NF-?B activation by targeting the IL1RAP coreceptor for ubiquitination and degradation.
22778412 2012 Interleukin-1R3 mediates interleukin-1-induced potassium current increase through fast activation of Akt kinase.
More...