Property Summary

Ligand Count 1
NCBI Gene PubMed Count 68
PubMed Score 53.28
PubTator Score 52.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
lung cancer -1.600 2.1e-02
adult high grade glioma 2.100 8.6e-06
Astrocytoma, Pilocytic 3.500 1.4e-14
glioblastoma 2.200 1.8e-06
intraductal papillary-mucinous neoplasm ... 1.600 3.2e-04
lung carcinoma -2.400 9.3e-26
non-small cell lung cancer 1.088 2.2e-09
ovarian cancer 1.200 1.4e-02
pancreatic cancer 1.100 3.5e-05
pancreatic ductal adenocarcinoma liver m... -1.349 4.4e-03
spina bifida -1.085 4.3e-02
tuberculosis -1.400 2.1e-04

Gene RIF (40)

AA Sequence

MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIW      1 - 70
YWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNS     71 - 140
PMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNY    141 - 210
TCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEV    211 - 280
WWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQK    281 - 350
VPAPRYTVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF    351 - 420
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENM    421 - 490
ASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQ    491 - 560
GLSYSSLKNV                                                                561 - 570
//

Text Mined References (78)

PMID Year Title